FC920189

Overview
NameFC920189
Unique NameFC920189
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length675
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15182 contig Ccv1_Contig15182:112..786. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920189 vs. ExPASy Swiss-Prot
Match: DCE_SOLLC (Glutamate decarboxylase OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 369.777 bits (948), Expect = 7.360e-102
Identity = 179/225 (79.56%), Postives = 198/225 (88.00%), Query Frame = 2
Query:    2 VISTTET-DPREILNSTFASRYVRAAIPRFKMPDNSMPKEAAYQVINDELMLDGNPRLNLASFVTTWMEPECDKLVMASINKNYVDMDEYPVTTELQNRCVNMIAHLFNTPVADDKTAVGVGTVGSSEAIMLAGLAFKRKWQQKRKEQGKPYDKPNIVTGANVQVCWEKFARYFXXXXXXXXXXXGYYVMNPVKAVELVDENTICVAAILGSTLTGEFEDVKLLH 673
            V++TT   D  E L+ TFASRYV+  +P+FKMP  SMPKEAAYQ++NDELMLDGNPRLNLASFV+TWMEPECDKL+M+SINKNYVDMDEYPVTTELQNRCVNM+AHLF+ PV DD+TAVGVGTVGSSEAIMLAGLAFKRKWQ KRK +GKP+DKPNIVTGANVQVCWEKFARYF           GYYVM+P KAVE+VDENTICVAAILGSTLTGEFEDVKLL+
Sbjct:    2 VLTTTSIRDSEESLHCTFASRYVQEPLPKFKMPKKSMPKEAAYQIVNDELMLDGNPRLNLASFVSTWMEPECDKLIMSSINKNYVDMDEYPVTTELQNRCVNMLAHLFHAPVGDDETAVGVGTVGSSEAIMLAGLAFKRKWQSKRKAEGKPFDKPNIVTGANVQVCWEKFARYFEVELKEVKLKEGYYVMDPAKAVEIVDENTICVAAILGSTLTGEFEDVKLLN 226          
BLAST of FC920189 vs. ExPASy Swiss-Prot
Match: DCE_PETHY (Glutamate decarboxylase OS=Petunia hybrida GN=GAD PE=1 SV=1)

HSP 1 Score: 366.311 bits (939), Expect = 8.137e-101
Identity = 180/224 (80.36%), Postives = 194/224 (86.61%), Query Frame = 2
Query:    2 VISTTETDPREILNSTFASRYVRAAIPRFKMPDNSMPKEAAYQVINDELMLDGNPRLNLASFVTTWMEPECDKLVMASINKNYVDMDEYPVTTELQNRCVNMIAHLFNTPVADDKTAVGVGTVGSSEAIMLAGLAFKRKWQQKRKEQGKPYDKPNIVTGANVQVCWEKFARYFXXXXXXXXXXXGYYVMNPVKAVELVDENTICVAAILGSTLTGEFEDVKLLH 673
            V+S T +     ++STFASRYVR ++PRFKMPDNS+PKEAAYQ+INDELMLDGNPRLNLASFVTTWMEPECDKL+M SINKNYVDMDEYPVTTELQNRCVNMIAHLFN P+ D +TAVGVGTVGSSEAIMLAGLAFKRKWQ K K QGKP DKPNIVTGANVQVCWEKFARYF           GYYVM+P KAVE+VDENTICVAAILGSTL GEFEDVK L+
Sbjct:    2 VLSKTVSQSDVSIHSTFASRYVRTSLPRFKMPDNSIPKEAAYQIINDELMLDGNPRLNLASFVTTWMEPECDKLMMDSINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLEDGETAVGVGTVGSSEAIMLAGLAFKRKWQNKMKAQGKPCDKPNIVTGANVQVCWEKFARYFEVELKEVKLSEGYYVMDPEKAVEMVDENTICVAAILGSTLNGEFEDVKRLN 225          
BLAST of FC920189 vs. ExPASy Swiss-Prot
Match: DCE1_ARATH (Glutamate decarboxylase 1 OS=Arabidopsis thaliana GN=GAD1 PE=1 SV=2)

HSP 1 Score: 363.999 bits (933), Expect = 4.038e-100
Identity = 176/224 (78.57%), Postives = 197/224 (87.95%), Query Frame = 2
Query:    2 VISTTETDPREILNSTFASRYVRAAIPRFKMPDNSMPKEAAYQVINDELMLDGNPRLNLASFVTTWMEPECDKLVMASINKNYVDMDEYPVTTELQNRCVNMIAHLFNTPVADDKTAVGVGTVGSSEAIMLAGLAFKRKWQQKRKEQGKPYDKPNIVTGANVQVCWEKFARYFXXXXXXXXXXXGYYVMNPVKAVELVDENTICVAAILGSTLTGEFEDVKLLH 673
            V+S   ++    ++STFASRYVR ++PRFKMP+NS+PKEAAYQ+INDELMLDGNPRLNLASFVTTWMEPECDKL+M+SINKNYVDMDEYPVTTELQNRCVNMIAHLFN P+ + +TAVGVGTVGSSEAIMLAGLAFKRKWQ KRK +GKP DKPNIVTGANVQVCWEKFARYF           GYYVM+P +AV++VDENTICVAAILGSTL GEFEDVKLL+
Sbjct:    2 VLSHAVSESDVSVHSTFASRYVRTSLPRFKMPENSIPKEAAYQIINDELMLDGNPRLNLASFVTTWMEPECDKLIMSSINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLEEAETAVGVGTVGSSEAIMLAGLAFKRKWQNKRKAEGKPVDKPNIVTGANVQVCWEKFARYFEVELKEVKLSEGYYVMDPQQAVDMVDENTICVAAILGSTLNGEFEDVKLLN 225          
BLAST of FC920189 vs. ExPASy Swiss-Prot
Match: DCE2_ARATH (Glutamate decarboxylase 2 OS=Arabidopsis thaliana GN=GAD2 PE=1 SV=1)

HSP 1 Score: 343.199 bits (879), Expect = 7.377e-94
Identity = 166/224 (74.11%), Postives = 189/224 (84.38%), Query Frame = 2
Query:    2 VISTTETDPREILNSTFASRYVRAAIPRFKMPDNSMPKEAAYQVINDELMLDGNPRLNLASFVTTWMEPECDKLVMASINKNYVDMDEYPVTTELQNRCVNMIAHLFNTPVADDKTAVGVGTVGSSEAIMLAGLAFKRKWQQKRKEQGKPYDKPNIVTGANVQVCWEKFARYFXXXXXXXXXXXGYYVMNPVKAVELVDENTICVAAILGSTLTGEFEDVKLLH 673
            V++ T T+   +  + F SRYVR  +P++++ +NS+PK+AAYQ+I DELMLDGNPRLNLASFVTTWMEPECDKL+M SINKNYVDMDEYPVTTELQNRCVN+IA LFN P+ + +TAVGVGTVGSSEAIMLAGLAFKRKWQ KRK +GKPYDKPNIVTGANVQVCWEKFARYF           GYYVM+P KA E+VDENTICVAAILGSTL GEFEDVK L+
Sbjct:    2 VLTKTATNDESVC-TMFGSRYVRTTLPKYEIGENSIPKDAAYQIIKDELMLDGNPRLNLASFVTTWMEPECDKLIMDSINKNYVDMDEYPVTTELQNRCVNIIARLFNAPLEESETAVGVGTVGSSEAIMLAGLAFKRKWQNKRKAEGKPYDKPNIVTGANVQVCWEKFARYFEVELKEVNLSEGYYVMDPDKAAEMVDENTICVAAILGSTLNGEFEDVKRLN 224          
BLAST of FC920189 vs. ExPASy Swiss-Prot
Match: DCEB_SHIFL (Glutamate decarboxylase beta OS=Shigella flexneri GN=gadB PE=2 SV=1)

HSP 1 Score: 186.422 bits (472), Expect = 1.154e-46
Identity = 96/219 (43.84%), Postives = 133/219 (60.73%), Query Frame = 2
Query:   20 TDPR-EILNSTFASRYVRAAIPRFKMPDNSMPKEAAYQVINDELMLDGNPRLNLASFVTTWMEPECDKLVMASINKNYVDMDEYPVTTELQNRCVNMIAHLFNTPVADDKTAVGVGTVGSSEAIMLAGLAFKRKWQQKRKEQGKPYDKPNIVTGANVQVCWEKFARYFXXXXXXXXXXXGYYVMNPVKAVELVDENTICVAAILGSTLTGEFEDVKLLH 673
            TD R E+L+S F ++ +       + P + M  + A+Q+INDEL LDGN R NLA+F  TW +    KL+  SINKN++D +EYP +  +  RCVNM+A L++ P   +  AVG  T+GSSEA ML G+A K +W+++ +  GKP DKPN+V G  VQ+CW KFARY+           G   M+P + +E  DENTI V    G T TG +E  + LH
Sbjct:    7 TDLRSELLDSRFGAKSISTIAESKRFPLHEMRDDVAFQIINDELYLDGNARQNLATFCQTWDDENVHKLMDLSINKNWIDKEEYPQSAAIDLRCVNMVADLWHAPAPKNGQAVGTNTIGSSEACMLGGMAMKWRWRKRMEAAGKPTDKPNLVCGP-VQICWHKFARYWDVELREIPMRPGQLFMDPKRMIEACDENTIGVVPTFGVTYTGNYEFPQPLH 224          
BLAST of FC920189 vs. ExPASy Swiss-Prot
Match: DCEB_ECOLI (Glutamate decarboxylase beta OS=Escherichia coli (strain K12) GN=gadB PE=1 SV=1)

HSP 1 Score: 186.422 bits (472), Expect = 1.154e-46
Identity = 96/219 (43.84%), Postives = 133/219 (60.73%), Query Frame = 2
Query:   20 TDPR-EILNSTFASRYVRAAIPRFKMPDNSMPKEAAYQVINDELMLDGNPRLNLASFVTTWMEPECDKLVMASINKNYVDMDEYPVTTELQNRCVNMIAHLFNTPVADDKTAVGVGTVGSSEAIMLAGLAFKRKWQQKRKEQGKPYDKPNIVTGANVQVCWEKFARYFXXXXXXXXXXXGYYVMNPVKAVELVDENTICVAAILGSTLTGEFEDVKLLH 673
            TD R E+L+S F ++ +       + P + M  + A+Q+INDEL LDGN R NLA+F  TW +    KL+  SINKN++D +EYP +  +  RCVNM+A L++ P   +  AVG  T+GSSEA ML G+A K +W+++ +  GKP DKPN+V G  VQ+CW KFARY+           G   M+P + +E  DENTI V    G T TG +E  + LH
Sbjct:    7 TDLRSELLDSRFGAKSISTIAESKRFPLHEMRDDVAFQIINDELYLDGNARQNLATFCQTWDDENVHKLMDLSINKNWIDKEEYPQSAAIDLRCVNMVADLWHAPAPKNGQAVGTNTIGSSEACMLGGMAMKWRWRKRMEAAGKPTDKPNLVCGP-VQICWHKFARYWDVELREIPMRPGQLFMDPKRMIEACDENTIGVVPTFGVTYTGNYEFPQPLH 224          
BLAST of FC920189 vs. ExPASy Swiss-Prot
Match: DCEB_ECO57 (Glutamate decarboxylase beta OS=Escherichia coli O157:H7 GN=gadB PE=2 SV=1)

HSP 1 Score: 186.422 bits (472), Expect = 1.154e-46
Identity = 96/219 (43.84%), Postives = 133/219 (60.73%), Query Frame = 2
Query:   20 TDPR-EILNSTFASRYVRAAIPRFKMPDNSMPKEAAYQVINDELMLDGNPRLNLASFVTTWMEPECDKLVMASINKNYVDMDEYPVTTELQNRCVNMIAHLFNTPVADDKTAVGVGTVGSSEAIMLAGLAFKRKWQQKRKEQGKPYDKPNIVTGANVQVCWEKFARYFXXXXXXXXXXXGYYVMNPVKAVELVDENTICVAAILGSTLTGEFEDVKLLH 673
            TD R E+L+S F ++ +       + P + M  + A+Q+INDEL LDGN R NLA+F  TW +    KL+  SINKN++D +EYP +  +  RCVNM+A L++ P   +  AVG  T+GSSEA ML G+A K +W+++ +  GKP DKPN+V G  VQ+CW KFARY+           G   M+P + +E  DENTI V    G T TG +E  + LH
Sbjct:    7 TDLRSELLDSRFGAKSISTIAESKRFPLHEMRDDVAFQIINDELYLDGNARQNLATFCQTWDDENVHKLMDLSINKNWIDKEEYPQSAAIDLRCVNMVADLWHAPAPKNGQAVGTNTIGSSEACMLGGMAMKWRWRKRMEAAGKPTDKPNLVCGP-VQICWHKFARYWDVELREIPMRPGQLFMDPKRMIEACDENTIGVVPTFGVTYTGNYEFPQPLH 224          
BLAST of FC920189 vs. ExPASy Swiss-Prot
Match: DCEA_SHIFL (Glutamate decarboxylase alpha OS=Shigella flexneri GN=gadA PE=2 SV=2)

HSP 1 Score: 186.037 bits (471), Expect = 1.507e-46
Identity = 93/214 (43.46%), Postives = 130/214 (60.75%), Query Frame = 2
Query:   32 EILNSTFASRYVRAAIPRFKMPDNSMPKEAAYQVINDELMLDGNPRLNLASFVTTWMEPECDKLVMASINKNYVDMDEYPVTTELQNRCVNMIAHLFNTPVADDKTAVGVGTVGSSEAIMLAGLAFKRKWQQKRKEQGKPYDKPNIVTGANVQVCWEKFARYFXXXXXXXXXXXGYYVMNPVKAVELVDENTICVAAILGSTLTGEFEDVKLLH 673
            E+L+S F ++ +       + P + M  + A+Q+INDEL LDGN R NLA+F  TW +    KL+  SINKN++D +EYP +  +  RCVNM+A L++ P   +  AVG  T+GSSEA ML G+A K +W+++ +  GKP DKPN+V G  VQ+CW KFARY+           G   M+P + +E  DENTI V    G T TG +E  + LH
Sbjct:   12 ELLDSRFGAKAISTIAESKRFPLHEMRDDVAFQIINDELYLDGNARQNLATFCQTWDDENVHKLMDLSINKNWIDKEEYPQSAAIDLRCVNMVADLWHAPAPKNGQAVGTNTIGSSEACMLGGMAMKWRWRKRMEAAGKPTDKPNLVCGP-VQICWHKFARYWDVELREIPMRPGQLFMDPKRMIEACDENTIGVVPTFGVTYTGNYEFPQPLH 224          
BLAST of FC920189 vs. ExPASy Swiss-Prot
Match: DCEA_ECOLI (Glutamate decarboxylase alpha OS=Escherichia coli (strain K12) GN=gadA PE=1 SV=1)

HSP 1 Score: 186.037 bits (471), Expect = 1.507e-46
Identity = 93/214 (43.46%), Postives = 130/214 (60.75%), Query Frame = 2
Query:   32 EILNSTFASRYVRAAIPRFKMPDNSMPKEAAYQVINDELMLDGNPRLNLASFVTTWMEPECDKLVMASINKNYVDMDEYPVTTELQNRCVNMIAHLFNTPVADDKTAVGVGTVGSSEAIMLAGLAFKRKWQQKRKEQGKPYDKPNIVTGANVQVCWEKFARYFXXXXXXXXXXXGYYVMNPVKAVELVDENTICVAAILGSTLTGEFEDVKLLH 673
            E+L+S F ++ +       + P + M  + A+Q+INDEL LDGN R NLA+F  TW +    KL+  SINKN++D +EYP +  +  RCVNM+A L++ P   +  AVG  T+GSSEA ML G+A K +W+++ +  GKP DKPN+V G  VQ+CW KFARY+           G   M+P + +E  DENTI V    G T TG +E  + LH
Sbjct:   12 ELLDSRFGAKAISTIAESKRFPLHEMRDDVAFQIINDELYLDGNARQNLATFCQTWDDENVHKLMDLSINKNWIDKEEYPQSAAIDLRCVNMVADLWHAPAPKNGQAVGTNTIGSSEACMLGGMAMKWRWRKRMEAAGKPTDKPNLVCGP-VQICWHKFARYWDVELREIPMRPGQLFMDPKRMIEACDENTIGVVPTFGVTYTGNYEFPQPLH 224          
BLAST of FC920189 vs. ExPASy Swiss-Prot
Match: DCEA_ECOL6 (Glutamate decarboxylase alpha OS=Escherichia coli O6 GN=gadA PE=1 SV=1)

HSP 1 Score: 186.037 bits (471), Expect = 1.507e-46
Identity = 93/214 (43.46%), Postives = 130/214 (60.75%), Query Frame = 2
Query:   32 EILNSTFASRYVRAAIPRFKMPDNSMPKEAAYQVINDELMLDGNPRLNLASFVTTWMEPECDKLVMASINKNYVDMDEYPVTTELQNRCVNMIAHLFNTPVADDKTAVGVGTVGSSEAIMLAGLAFKRKWQQKRKEQGKPYDKPNIVTGANVQVCWEKFARYFXXXXXXXXXXXGYYVMNPVKAVELVDENTICVAAILGSTLTGEFEDVKLLH 673
            E+L+S F ++ +       + P + M  + A+Q+INDEL LDGN R NLA+F  TW +    KL+  SINKN++D +EYP +  +  RCVNM+A L++ P   +  AVG  T+GSSEA ML G+A K +W+++ +  GKP DKPN+V G  VQ+CW KFARY+           G   M+P + +E  DENTI V    G T TG +E  + LH
Sbjct:   12 ELLDSRFGAKAISTIAESKRFPLHEMRDDVAFQIINDELYLDGNARQNLATFCQTWDDENVHKLMDLSINKNWIDKEEYPQSAAIDLRCVNMVADLWHAPAPKNGQAVGTNTIGSSEACMLGGMAMKWRWRKRMEAAGKPTDKPNLVCGP-VQICWHKFARYWDVELREIPMRPGQLFMDPKRMIEACDENTIGVVPTFGVTYTGNYEFPQPLH 224          
The following BLAST results are available for this feature:
BLAST of FC920189 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 22
Match NameE-valueIdentityDescription
DCE_SOLLC7.360e-10279.56Glutamate decarboxylase OS=Solanum lycopersicum PE... [more]
DCE_PETHY8.137e-10180.36Glutamate decarboxylase OS=Petunia hybrida GN=GAD ... [more]
DCE1_ARATH4.038e-10078.57Glutamate decarboxylase 1 OS=Arabidopsis thaliana ... [more]
DCE2_ARATH7.377e-9474.11Glutamate decarboxylase 2 OS=Arabidopsis thaliana ... [more]
DCEB_SHIFL1.154e-4643.84Glutamate decarboxylase beta OS=Shigella flexneri ... [more]
DCEB_ECOLI1.154e-4643.84Glutamate decarboxylase beta OS=Escherichia coli (... [more]
DCEB_ECO571.154e-4643.84Glutamate decarboxylase beta OS=Escherichia coli O... [more]
DCEA_SHIFL1.507e-4643.46Glutamate decarboxylase alpha OS=Shigella flexneri... [more]
DCEA_ECOLI1.507e-4643.46Glutamate decarboxylase alpha OS=Escherichia coli ... [more]
DCEA_ECOL61.507e-4643.46Glutamate decarboxylase alpha OS=Escherichia coli ... [more]

Pages

back to top
Libraries
Library NameType
RVDevelop1cdna_library
Properties
Property NameValue
Genbank descriptionC32005B07EF RVDevelop1 Citrus clementina cDNA clone C32005B07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920189 ID=FC920189|Name=FC920189|organism=Citrus clementina|type=EST|length=675bp
GGTGATTTCAACAACAGAAACAGACCCCAGGGAGATTTTGAACTCCACAT
TTGCTTCAAGATATGTCCGTGCTGCTATTCCCAGATTCAAGATGCCAGAT
AATTCAATGCCAAAGGAGGCAGCCTATCAGGTAATAAATGATGAGCTGAT
GTTAGATGGAAATCCAAGGCTGAACTTGGCATCTTTTGTGACCACTTGGA
TGGAGCCCGAGTGTGATAAGCTTGTCATGGCTTCGATTAATAAAAACTAT
GTTGACATGGATGAATACCCTGTAACCACAGAGCTCCAGAATCGGTGTGT
GAATATGATTGCCCACCTATTTAATACTCCAGTTGCGGATGACAAGACTG
CAGTGGGCGTGGGGACTGTAGGTTCATCAGAGGCAATAATGCTTGCTGGC
TTGGCTTTTAAAAGGAAGTGGCAGCAGAAGAGAAAAGAGCAAGGCAAACC
CTATGATAAGCCCAATATAGTCACTGGAGCTAATGTGCAGGTATGCTGGG
AGAAATTTGCGAGGTACTTTGAGGTTGAGCTGAAGGAGGTGAAACTGGAA
GAGGGATATTATGTGATGAATCCTGTGAAAGCTGTTGAGTTGGTAGATGA
GAACACCATTTGTGTTGCAGCCATTCTGGGATCAACCTTGACGGGAGAAT
TTGAGGATGTTAAGCTTCTTCATGA
back to top