FC920190

Overview
NameFC920190
Unique NameFC920190
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length666
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig8167 contig Ccv1_Contig8167:15..680. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920190 vs. ExPASy Swiss-Prot
Match: HPPD_ARATH (4-hydroxyphenylpyruvate dioxygenase OS=Arabidopsis thaliana GN=HPD PE=1 SV=2)

HSP 1 Score: 288.5 bits (737), Expect = 2.098e-77
Identity = 140/210 (66.67%), Postives = 163/210 (77.62%), Query Frame = 3
Query:   39 KLVGFKNFVRQNPPSDRFRVNRFHHVEFWCTDATNTARRFSWGLGMPIVAKSDLSTGNTVHASYLLRSGDLRFVFTAPYSPXXXXXXXXXXXXXXLPTFDHAACRSFAASHGLAARSIAVEVEDADVAFNTSVAHGAKPSSPPVILDNLAVIAEVQLYGDVVLRYVSYK-DKANHLDFLPGFEPTDEISSFPLDYGIRRLDHAVRYVPEL 665
            KLVGF  FVR+NP SD+F+V RFHH+EFWC DATN ARRFSWGLGM   AKSDLSTGN VHASYLL SGDLRF+FTAPYSP              +P+FDH +CRSF +SHGL  R++A+EVEDA+ AF+ SVA+GA PSSPP++L+    IAEV+LYGDVVLRYVSYK +     +FLPGFE  ++ SSFPLDYGIRRLDHAV  VPEL
Sbjct:   25 KLVGFSKFVRKNPKSDKFKVKRFHHIEFWCGDATNVARRFSWGLGMRFSAKSDLSTGNMVHASYLLTSGDLRFLFTAPYSPSLSAGEIKPTTTASIPSFDHGSCRSFFSSHGLGVRAVAIEVEDAESAFSISVANGAIPSSPPIVLNEAVTIAEVKLYGDVVLRYVSYKAEDTEKSEFLPGFERVEDASSFPLDYGIRRLDHAVGNVPEL 234          
BLAST of FC920190 vs. ExPASy Swiss-Prot
Match: HPPD_DAUCA (4-hydroxyphenylpyruvate dioxygenase OS=Daucus carota PE=2 SV=1)

HSP 1 Score: 256.144 bits (653), Expect = 1.154e-67
Identity = 135/221 (61.09%), Postives = 158/221 (71.49%), Query Frame = 3
Query:    6 NNGHQTAELLVKLVGFKNFVRQNPPSDRFRVNRFHHVEFWCTDATNTARRFSWGLGMPIVAKSDLSTGNTVHASYLLRSGDLRFVFTAPYSPXXXXXXXXXXXXXXLPTFDHAACRSFAASHGLAARSIAVEVEDADVAFNTSVAHGAKPSSPPVILDNLAVIAEVQLYGDVVLRYVSYKDKANHLDFLPGFEPTDEISSFP-LDYGIRRLDHAVRYVPEL 665
            +N   T+    KLVGF NFVR NP SD F V RFHH+EFWC DATNT+RRFSWGLGMP+VAKSDLSTGN+VHASYL+RS +L FVFTAPYSP              +P+F  +   SFAA HGLA R+IA+EV D   AF  SVA GA+P+S PV LD+ A +AEV+LYGDVVLR+VS+  +     FLPGFE  +  +SFP LDYGIRRLDHAV  V EL
Sbjct:   13 SNSSNTSPATFKLVGFNNFVRANPKSDHFAVKRFHHIEFWCGDATNTSRRFSWGLGMPLVAKSDLSTGNSVHASYLVRSANLSFVFTAPYSP----STTTSSGSAAIPSFSASGFHSFAAKHGLAVRAIALEVADVAAAFEASVARGARPASAPVELDDQAWLAEVELYGDVVLRFVSFGREEGL--FLPGFEAVEGTASFPDLDYGIRRLDHAVGNVTEL 227          
BLAST of FC920190 vs. ExPASy Swiss-Prot
Match: HPPD_SOLSC (4-hydroxyphenylpyruvate dioxygenase OS=Solenostemon scutellarioides PE=2 SV=1)

HSP 1 Score: 245.743 bits (626), Expect = 1.560e-64
Identity = 131/211 (62.09%), Postives = 154/211 (72.99%), Query Frame = 3
Query:   39 KLVGFKNFVRQNPPSDRFRVNRFHHVEFWCTDATNTARRFSWGLGMPIVAKSDLSTGNTVHASYLLRSGDLRFVFTAPYSPXXXXXXXXXXXXXXLPTFDHAACRSFAASHGLAARSIAVEVEDADVAFNTSVAHGAKPSSPPVIL-DNLAVIAEVQLYGDVVLRYVSYKDKANHLDFLPGFEPT-DEISSFPLDYGIRRLDHAVRYVPEL 665
            KLVG KNFVR NP SD F V+RFHHVEFWC DATNT+RRFSWGLGMP+VAKSDLSTGN+ HASYLLRSG+L FVFTAPYSP              +PTF  +  R+F +SHGLA R++A++V+ A  A++ +V+ GAKP SPPV+L D    IAEV LYGD VLR+VS    A+   FLPGFE   D +S   LDYGIRRLDHAV  VP+L
Sbjct:   17 KLVGHKNFVRSNPMSDHFPVHRFHHVEFWCGDATNTSRRFSWGLGMPLVAKSDLSTGNSAHASYLLRSGELSFVFTAPYSP-----SLAEPSSASIPTFSFSDHRAFTSSHGLAVRAVAIQVDSASSAYSAAVSRGAKPVSPPVVLADCETAIAEVHLYGDTVLRFVSCGSGADGW-FLPGFEVVGDGVSCQELDYGIRRLDHAVGNVPKL 221          
BLAST of FC920190 vs. ExPASy Swiss-Prot
Match: HPPD_HORVU (4-hydroxyphenylpyruvate dioxygenase OS=Hordeum vulgare PE=2 SV=1)

HSP 1 Score: 187.963 bits (476), Expect = 3.859e-47
Identity = 103/201 (51.24%), Postives = 125/201 (62.19%), Query Frame = 3
Query:   63 VRQNPPSDRFRVNRFHHVEFWCTDATNTARRFSWGLGMPIVAKSDLSTGNTVHASYLLRSGDLRFVFTAPYSPXXXXXXXXXXXXXXLPTFDHAACRSFAASHGLAARSIAVEVEDADVAFNTSVAHGAKPSSPPVILDNLAVIAEVQLYGDVVLRYVSYKDKANHLDFLPGFEPTDEISSFPLDYGIRRLDHAVRYVPEL 665
            VR NP SDRF    FHHVEFWC DA + A RF++ LG P+ A+SDLSTGN+ HAS LLRSG L F+FTAPY+               LP+F   A R F+A HG+A RS+A+ V DA  AF  S   GA+P+  PV L      AEV+LYGDVVLR+VS+ D    + FLPGFE      +  +DYG+ R DH V  VPEL
Sbjct:   28 VRFNPRSDRFHTLSFHHVEFWCADAASAAGRFAFALGAPLAARSDLSTGNSAHASQLLRSGSLAFLFTAPYA------NGCDAATASLPSFSADAARRFSADHGIAVRSVALRVADAAEAFRASRRRGARPAFAPVDLGRGFAFAEVELYGDVVLRFVSHPD-GTDVPFLPGFEGVTNPDA--VDYGLTRFDHVVGNVPEL 219          
BLAST of FC920190 vs. ExPASy Swiss-Prot
Match: HPPD_NEUCR (4-hydroxyphenylpyruvate dioxygenase OS=Neurospora crassa GN=B23G1.170 PE=3 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 1.173e-11
Identity = 55/193 (28.50%), Postives = 80/193 (41.45%), Query Frame = 3
Query:   99 NRFHHVEFWCTDATNTARRFSWGLGMPIVAKSDLSTGNTVHASYLLRSGDLRFVFTAPYSPXXXXXXXXXXXXXXLPTFDHAACRSFAASHGLAARSIAVEVEDADVAFNTSVAHGAKPSSPPVILDN----LAVIAEVQLYGDVVLRYVSYKDKANHLDFLPGF------EPTDEISSFPLDYGIRRLDHAV 647
            N + HV +W  +A   A  ++   G   +A   L TG+   ASY++ + D+RFVFT+P                         C      HG A + +A EV++ D  F+ +VA GA     P  L +        A ++ YGD     +S  D      FLPGF        T ++ S PL     R+DH V
Sbjct:   30 NGYDHVTWWVGNAKQAASYYNTVFGFKTLAYRGLETGSRYFASYVVGNADVRFVFTSPIRSQKCLPEEEPISDADRKLLQE--CHEHLEKHGDAVKDVAFEVDNVDGVFHKAVAAGADVVQEPTTLTDKMHGSVRTAVIRTYGDTTHTLISRADYNG--PFLPGFRTAAPSSATVQLPSVPL----ARIDHCV 214          
BLAST of FC920190 vs. ExPASy Swiss-Prot
Match: HPPD_MAGGR (4-hydroxyphenylpyruvate dioxygenase OS=Magnaporthe grisea GN=HPD4 PE=3 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 4.457e-11
Identity = 54/194 (27.84%), Postives = 84/194 (43.30%), Query Frame = 3
Query:  105 FHHVEFWCTDATNTARRFSWGLGMPIVAKSDLSTGNTVHASYLLRSGDLRFVFTAPYSPXXXXXXXXXXXXXXLPTFDHAACRSFAA---SHGLAARSIAVEVEDADVAFNTSVAHGAKPSSPPVILDN----LAVIAEVQLYGDVVLRYVSYKDKANHLDFLPGFEPTDEISSFPLDYG------IRRLDHAV 647
            + HV +W  +A   A  ++   GM I+A   L TG+   ASYL+   D+RFVFT+P                 +   D A  +   A    HG A + +  EV++    +  +V  GA   +PP  L +       +A +Q YGD     +S  +      FLPGF    +++  P  Y       ++R+DH V
Sbjct:   38 YDHVTWWVGNAKQAASYYNTLFGMKIIAYRGLETGSRYFASYLVGKEDVRFVFTSP-----IRSHVHLPEDEPISDEDRALLKEMHAHLEKHGDAVKDVCFEVDNVQGVYERAVQQGAVSIAPPKTLSDKEHGSVTMAVIQTYGDTTHTLLSRDNFRG--TFLPGFR---DVNRQPAAYSALAPVPLQRIDHCV 221          
The following BLAST results are available for this feature:
BLAST of FC920190 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 6
Match NameE-valueIdentityDescription
HPPD_ARATH2.098e-7766.674-hydroxyphenylpyruvate dioxygenase OS=Arabidopsis... [more]
HPPD_DAUCA1.154e-6761.094-hydroxyphenylpyruvate dioxygenase OS=Daucus caro... [more]
HPPD_SOLSC1.560e-6462.094-hydroxyphenylpyruvate dioxygenase OS=Solenostemo... [more]
HPPD_HORVU3.859e-4751.244-hydroxyphenylpyruvate dioxygenase OS=Hordeum vul... [more]
HPPD_NEUCR1.173e-1128.504-hydroxyphenylpyruvate dioxygenase OS=Neurospora ... [more]
HPPD_MAGGR4.457e-1127.844-hydroxyphenylpyruvate dioxygenase OS=Magnaporthe... [more]
back to top
Libraries
Library NameType
RVDevelop1cdna_library
Properties
Property NameValue
Genbank descriptionC32005B09EF RVDevelop1 Citrus clementina cDNA clone C32005B09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920190 ID=FC920190|Name=FC920190|organism=Citrus clementina|type=EST|length=666bp
ATAAGAATAATGGGCATCAAACCGCTGAATTGCTGGTCAAGCTCGTCGGG
TTCAAAAACTTCGTCCGCCAGAATCCCCCATCGGACCGGTTCCGAGTGAA
CCGCTTCCACCATGTCGAGTTCTGGTGCACTGACGCCACCAATACGGCTC
GTCGTTTCTCCTGGGGACTCGGCATGCCCATTGTCGCCAAATCGGACTTG
TCTACCGGCAACACTGTCCATGCATCTTACCTCTTACGTTCTGGCGACCT
CCGTTTCGTCTTTACGGCGCCGTATTCCCCTTCAATCTCCGACGCCGCCG
ATGCTGGCAACTCCTCAGCATCTCTCCCGACTTTCGACCACGCAGCTTGC
CGCAGTTTCGCCGCGTCTCATGGGCTCGCCGCGCGGTCGATTGCTGTTGA
AGTTGAAGACGCCGACGTTGCTTTCAACACCAGCGTGGCTCACGGTGCTA
AGCCCTCCTCTCCTCCTGTGATTCTCGATAACCTTGCTGTGATTGCCGAG
GTCCAGTTATACGGCGACGTCGTTTTGCGTTATGTTAGTTATAAAGATAA
AGCGAATCATCTTGATTTCCTGCCGGGTTTCGAACCGACGGATGAGATTT
CATCGTTTCCGTTGGATTACGGAATCAGGCGGCTCGATCACGCCGTNCGG
TACGTTCCGGAACTCG
back to top