FC920192

Overview
NameFC920192
Unique NameFC920192
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length707
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC920192_ssr62 microsatellite FC920192_ssr62:62..73. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig12975 contig Ccv1_Contig12975:39..746. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920192 vs. ExPASy Swiss-Prot
Match: C77A3_SOYBN (Cytochrome P450 77A3 OS=Glycine max GN=CYP77A3 PE=2 SV=1)

HSP 1 Score: 240.736 bits (613), Expect = 2.293e-72
Identity = 123/176 (69.89%), Postives = 141/176 (80.11%), Query Frame = 3
Query:   90 HLFFTFLAFLLSGLIFFLASRKTKSKRXXXXXXXXXXXXXXXXFQVARSGKPFFKYVDDLLPIYGPIFTLRMGTRTMIILSDAKLVHEALIEKGSLFATRPRENPTRTIFSCNKFTVNAALYGPVWRSLRRNMVQNMLSSSRIREFREVRDKAMDKLINRLKAEAEATNGIVWVLK 617
            H  FT LAF +SGLIFFL  +K+KSK+                FQVARSGKPFF+YV+D+   YG IFTL+MGTRTMIIL+DAKLVHEA+I+KG+ +ATRP ENPTRTIFS NKFTVNAA YGPVW+SLRRNMVQNMLSS+R++EFR VRD AMDKLINRLK EAE  NG+VWVLK
Sbjct:    9 HFIFTALAFFISGLIFFL-KQKSKSKKFNLPPGPPGWPIVGNLFQVARSGKPFFEYVNDVRLKYGSIFTLKMGTRTMIILTDAKLVHEAMIQKGATYATRPPENPTRTIFSENKFTVNAATYGPVWKSLRRNMVQNMLSSTRLKEFRSVRDNAMDKLINRLKDEAEKNNGVVWVLK 183          

HSP 2 Score: 52.373 bits (124), Expect = 2.293e-72
Identity = 21/30 (70.00%), Postives = 29/30 (96.67%), Query Frame = 2
Query:  617 NARFAVFCILLAMCFGIDMDEKTIEKMDXV 706
            +ARFAVFCIL+AMCFG++MDE+T+E++D V
Sbjct:  184 DARFAVFCILVAMCFGLEMDEETVERIDQV 213          
BLAST of FC920192 vs. ExPASy Swiss-Prot
Match: C77A2_SOLME (Cytochrome P450 77A2 OS=Solanum melongena GN=CYP77A2 PE=2 SV=1)

HSP 1 Score: 231.106 bits (588), Expect = 4.255e-71
Identity = 117/185 (63.24%), Postives = 144/185 (77.84%), Query Frame = 3
Query:   63 SSSSMAVAIHLFFTFLAFLLSGLIFFLASRKTKSKRXXXXXXXXXXXXXXXXFQVARSGKPFFKYVDDLLPIYGPIFTLRMGTRTMIILSDAKLVHEALIEKGSLFATRPRENPTRTIFSCNKFTVNAALYGPVWRSLRRNMVQNMLSSSRIREFREVRDKAMDKLINRLKAEAEATNGIVWVLK 617
            S+SS++   HL FT LAF++S +I+FL S+K +SK+                 QVARSGKPFF+ + +L   YGPIFTLRMGTRTMIILS+A LVHEALI KG +FATRPRENPTRT+FSC+KFTVNAA+YGPVWRSLR+NMVQN LSS R++EFR VR  AMDK+I +++AEA+A  G+VWVLK
Sbjct:    5 STSSLSSYYHLIFTILAFVISSIIYFL-SKKAESKKLKLPPGPPGWPVVGNLLQVARSGKPFFQIMRELRQKYGPIFTLRMGTRTMIILSNADLVHEALILKGQVFATRPRENPTRTVFSCDKFTVNAAVYGPVWRSLRKNMVQNGLSSIRLKEFRAVRKSAMDKMIEKIRAEADANEGVVWVLK 188          

HSP 2 Score: 57.7658 bits (138), Expect = 4.255e-71
Identity = 25/28 (89.29%), Postives = 28/28 (100.00%), Query Frame = 2
Query:  617 NARFAVFCILLAMCFGIDMDEKTIEKMD 700
            NARFAVFCILLAMCFG++MDEKTIEK+D
Sbjct:  189 NARFAVFCILLAMCFGVEMDEKTIEKID 216          
BLAST of FC920192 vs. ExPASy Swiss-Prot
Match: C77A1_SOLME (Cytochrome P450 77A1 (Fragment) OS=Solanum melongena GN=CYP77A1 PE=2 SV=1)

HSP 1 Score: 213.001 bits (541), Expect = 3.491e-61
Identity = 108/172 (62.79%), Postives = 129/172 (75.00%), Query Frame = 3
Query:  105 FLAF-LLSGLIFFLASRKTKSKRXXXXXXXXXXXXXXXXFQVARSGKPFFKYVDDLLPIYGPIFTLRMGTRTMIILSDAKLVHEALIEKGSLFATRPRENPTRTIFSCNKFTVNAALYGPVWRSLRRNMVQNMLSSSRIREFREVRDKAMDKLINRLKAEAEATNGIVWVLK 617
            F AF LL  L  FL +RK KSK                 FQVA SGK FF+Y+ DL P YG IFTL+MG+RTMII++ A+L HEALI+KG +FA+RPRENPTRTIFSCNKF+VNAA+YGPVWRSLRRNMVQNMLS SR++EFRE R+ AMDKLI R++ +A+  N +VW LK
Sbjct:    2 FTAFSLLFSLFIFLLTRKPKSKTPNLPPGPPGWPIVGNLFQVAGSGKQFFEYIRDLKPKYGSIFTLKMGSRTMIIVASAELAHEALIQKGQIFASRPRENPTRTIFSCNKFSVNAAVYGPVWRSLRRNMVQNMLSPSRLKEFREFREIAMDKLIERIRVDAKENNDVVWALK 173          

HSP 2 Score: 42.743 bits (99), Expect = 3.491e-61
Identity = 20/29 (68.97%), Postives = 26/29 (89.66%), Query Frame = 2
Query:  617 NARFAVFCILLAMCFGIDMD-EKTIEKMD 700
            NARFAVF IL+AMCFG++MD E+ IE++D
Sbjct:  174 NARFAVFYILVAMCFGVEMDNEEMIERVD 202          
BLAST of FC920192 vs. ExPASy Swiss-Prot
Match: C89A2_ARATH (Cytochrome P450 89A2 OS=Arabidopsis thaliana GN=CYP89A2 PE=2 SV=2)

HSP 1 Score: 66.6254 bits (161), Expect = 2.948e-14
Identity = 34/98 (34.69%), Postives = 54/98 (55.10%), Query Frame = 3
Query:  282 GPIFTLRMGTRTMIILSDAKLVHEALIEKGSLFATRPRENPTRTIFSCNKFTVNAALYGPVWRSLRRNMVQNMLSSSRIREFREVRDKAMDKLINRLK 575
            GPI TLR+ +R  I ++D  L HEAL+  G+++A RP   P       ++  +++  YG  WR LRRN+   +L  SR+R +   R   ++ L  R +
Sbjct:   66 GPIVTLRITSRPAIFVADRSLTHEALVLNGAVYADRP--PPAVISKIVDEHNISSGSYGATWRLLRRNITSEILHPSRVRSYSHARHWVLEILFERFR 161          

HSP 2 Score: 31.5722 bits (70), Expect = 2.948e-14
Identity = 11/27 (40.74%), Postives = 21/27 (77.78%), Query Frame = 2
Query:  626 FAVFCILLAMCFGIDMDEKTIEKMDXV 706
            +A+F +L+ MCFG  +DEK I++++ +
Sbjct:  177 YAMFALLVLMCFGDKLDEKQIKEVEFI 203          
The following BLAST results are available for this feature:
BLAST of FC920192 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
C77A3_SOYBN2.293e-7269.89Cytochrome P450 77A3 OS=Glycine max GN=CYP77A3 PE=... [more]
C77A2_SOLME4.255e-7163.24Cytochrome P450 77A2 OS=Solanum melongena GN=CYP77... [more]
C77A1_SOLME3.491e-6162.79Cytochrome P450 77A1 (Fragment) OS=Solanum melonge... [more]
C89A2_ARATH2.948e-1434.69Cytochrome P450 89A2 OS=Arabidopsis thaliana GN=CY... [more]
back to top
Libraries
Library NameType
RVDevelop1cdna_library
Properties
Property NameValue
Genbank descriptionC32005B12EF RVDevelop1 Citrus clementina cDNA clone C32005B12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920192 ID=FC920192|Name=FC920192|organism=Citrus clementina|type=EST|length=707bp
GCTGCACATCATAAAATCTTCCTCCAGCTCTTCTCTAGCATCAACTCTTT
TCACCTCATCTATCATCATCATCAATGGCAGTGGCGATTCATCTCTTCTT
CACTTTCCTAGCTTTTCTTCTTTCAGGGTTAATTTTCTTTCTAGCTTCCC
GGAAAACAAAATCAAAACGTCCGAATCTTCCTCCAGGCCCTCCGGGCTGG
CCAGTTGTTGGCAATCTCTTCCAAGTAGCTCGCTCCGGCAAGCCTTTCTT
CAAATACGTCGATGATCTTCTCCCAATATACGGTCCGATTTTCACCCTCA
GGATGGGAACAAGAACCATGATCATCCTGAGCGACGCCAAGCTAGTCCAC
GAAGCCCTCATCGAAAAGGGTAGTCTCTTCGCCACTCGCCCTAGAGAAAA
CCCTACCAGAACCATCTTCAGCTGCAACAAGTTCACCGTCAACGCCGCCC
TTTACGGGCCCGTCTGGCGGTCCCTGCGAAGAAACATGGTGCAGAACATG
CTCAGTTCAAGCAGAATTAGGGAGTTCCGTGAAGTCAGAGACAAGGCAAT
GGATAAATTAATCAACAGGCTCAAAGCTGAAGCCGAAGCTACCAACGGAA
TCGTTTGGGTGCTTAAAACGCCCGTTTCGCCGTGTTCTGTATCCTACTAG
CTATGTGTTTTGGGATTGACATGGATGAGAAGACGATTGAGAAAATGGAT
NCAGTGA
back to top