FC920195

Overview
NameFC920195
Unique NameFC920195
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length580
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14357 contig Ccv1_Contig14357:73..652. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920195 vs. ExPASy Swiss-Prot
Match: VDAC1_ARATH (Mitochondrial outer membrane protein porin 1 OS=Arabidopsis thaliana GN=At3g01280 PE=1 SV=3)

HSP 1 Score: 183.341 bits (464), Expect = 7.277e-46
Identity = 90/173 (52.02%), Postives = 123/173 (71.10%), Query Frame = 1
Query:   52 MSKGPGLFADIGKKAKDLLTKDYNADQKISISTYSGAGVALTSTAVKKGGLSAGDVAAQYKYKNVLFDVKVDTESNILTTFTLTEILPSTKAIASLKVPDYNSGKLEVQYFHDHATFTSAIALNQSPCIDVTATIGTPSIAFGAEAGYDTTSGNFTKYTAGISVTKPDSCASI 570
            M KGPGL+ +IGKKA+DLL KD+N+DQK SI+T+S AGVA+TST  KKG L  GDVA Q + KN+  D+KV T+S  L T T+ E  P  ++I S KVPD NSGK+E+QY H++A  ++++ L Q+P ++ +  IG+  +A G +  +DT SGNFTK  AG+S TK D  AS+
Sbjct:    1 MVKGPGLYTEIGKKARDLLYKDHNSDQKFSITTFSPAGVAITSTGTKKGDLLLGDVAFQSRRKNITTDLKVCTDSTFLITATVDEAAPGLRSIFSFKVPDQNSGKVELQYLHEYAGISTSMGLTQNPTVNFSGVIGSNVLAVGTDVSFDTKSGNFTKINAGLSFTKEDLIASL 173          
BLAST of FC920195 vs. ExPASy Swiss-Prot
Match: VDAC_PEA (Outer plastidial membrane protein porin OS=Pisum sativum GN=POR1 PE=1 SV=2)

HSP 1 Score: 182.185 bits (461), Expect = 1.621e-45
Identity = 88/175 (50.29%), Postives = 120/175 (68.57%), Query Frame = 1
Query:   52 MSKGPGLFADIGKKAKDLLTKDYNADQKISISTYSGAGVALTSTAVKKGGLSAGDVAAQYKYKNVLFDVKVDTESNILTTFTLTEILPSTKAIASLKVPDYNSGKLEVQYFHDHATFTSAIALNQSPCIDVTATIGTPSIAFGAEAGYDTTSGNFTKYTAGISVTKPDSCASIIL 576
            M KGPGL+ DIGKKA+DLL KDY++D+K +ISTYS  GVA+TS+  KKG L  GDV  Q K KN+  D+KVDT SN+ TT T+ E  P  KAI S KVP+  SGK+E+QY H++A  +S++ L  +P ++ ++ IGT ++AFGA+  +DT  G  TK  A ++  K D   S+ L
Sbjct:    1 MVKGPGLYTDIGKKARDLLYKDYHSDKKFTISTYSPTGVAITSSGTKKGELFLGDVNTQLKNKNITTDIKVDTNSNLFTTITVNEPAPGVKAILSFKVPEQTSGKVELQYLHEYAGISSSVGLKANPIVNFSSVIGTNALAFGADISFDTKLGELTKSNAAVNFVKDDLIGSLTL 175          
BLAST of FC920195 vs. ExPASy Swiss-Prot
Match: VDAC2_ARATH (Mitochondrial outer membrane protein porin 2 OS=Arabidopsis thaliana GN=HSR2 PE=1 SV=3)

HSP 1 Score: 180.644 bits (457), Expect = 4.717e-45
Identity = 85/175 (48.57%), Postives = 115/175 (65.71%), Query Frame = 1
Query:   52 MSKGPGLFADIGKKAKDLLTKDYNADQKISISTYSGAGVALTSTAVKKGGLSAGDVAAQYKYKNVLFDVKVDTESNILTTFTLTEILPSTKAIASLKVPDYNSGKLEVQYFHDHATFTSAIALNQSPCIDVTATIGTPSIAFGAEAGYDTTSGNFTKYTAGISVTKPDSCASIIL 576
            M KGPGL+ +IGKKA+DLL +DY  DQK S++TYS  GVA+T+T   KG L  GDVA Q K  N   DVKV T+S++LTT T  E  P  K I   K+PD+ SGK EVQYFHD+A  ++++    +P ++ +  +GT  ++ G +  Y+T SGNF  + AG + TK D  AS+IL
Sbjct:    1 MVKGPGLYTEIGKKARDLLYRDYQGDQKFSVTTYSSTGVAITTTGTNKGSLFLGDVATQVKNNNFTADVKVSTDSSLLTTLTFDEPAPGLKVIVQAKLPDHKSGKAEVQYFHDYAGISTSVGFTATPIVNFSGVVGTNGLSLGTDVAYNTESGNFKHFNAGFNFTKDDLTASLIL 175          
BLAST of FC920195 vs. ExPASy Swiss-Prot
Match: VDAC1_SOLTU (Mitochondrial outer membrane protein porin of 34 kDa OS=Solanum tuberosum PE=1 SV=2)

HSP 1 Score: 180.644 bits (457), Expect = 4.717e-45
Identity = 89/175 (50.86%), Postives = 115/175 (65.71%), Query Frame = 1
Query:   52 MSKGPGLFADIGKKAKDLLTKDYNADQKISISTYSGAGVALTSTAVKKGGLSAGDVAAQYKYKNVLFDVKVDTESNILTTFTLTEILPSTKAIASLKVPDYNSGKLEVQYFHDHATFTSAIALNQSPCIDVTATIGTPSIAFGAEAGYDTTSGNFTKYTAGISVTKPDSCASIIL 576
            M KGPGL+ +IGKKA+DLL KDY +D K SI+TYS  GV +TS+  KKG L   DV  Q K KNV  D+KVDT SN+ TT T+ E  P  K I S +VPD  SGKLEVQY HD+A   +++ L  +P ++ +  +GT  IA G +  +DT +G+FTK  AG+S T  D  AS+ L
Sbjct:    1 MGKGPGLYTEIGKKARDLLYKDYQSDHKFSITTYSPTGVVITSSGSKKGDLFLADVNTQLKNKNVTTDIKVDTNSNLFTTITVDEAAPGLKTILSFRVPDQRSGKLEVQYLHDYAGICTSVGLTANPIVNFSGVVGTNIIALGTDVSFDTKTGDFTKCNAGLSFTNADLVASLNL 175          
BLAST of FC920195 vs. ExPASy Swiss-Prot
Match: VDAC2_SOLTU (Mitochondrial outer membrane protein porin of 36 kDa OS=Solanum tuberosum PE=1 SV=2)

HSP 1 Score: 174.096 bits (440), Expect = 4.415e-43
Identity = 84/175 (48.00%), Postives = 117/175 (66.86%), Query Frame = 1
Query:   52 MSKGPGLFADIGKKAKDLLTKDYNADQKISISTYSGAGVALTSTAVKKGGLSAGDVAAQYKYKNVLFDVKVDTESNILTTFTLTEILPSTKAIASLKVPDYNSGKLEVQYFHDHATFTSAIALNQSPCIDVTATIGTPSIAFGAEAGYDTTSGNFTKYTAGISVTKPDSCASIIL 576
            M KGPGL++DIGKKA+DLL +DY +D K +++TYS  GVA+T++ +KKG L   DV+ Q K KN+  DVKVDT SN+ TT T+ E  P  K I S  VPD  SGK+E+QY H++A   ++I L  SP ++ +   G  ++A G +  +DT +GNFTK  AG+S +  D  AS+ L
Sbjct:    1 MVKGPGLYSDIGKKARDLLYRDYVSDHKFTVTTYSTTGVAITASGLKKGELFLADVSTQLKNKNITTDVKVDTNSNVYTTITVDEPAPGLKTIFSFVVPDQKSGKVELQYLHEYAGINTSIGLTASPLVNFSGVAGNNTVALGTDLSFDTATGNFTKCNAGLSFSSSDLIASLAL 175          
BLAST of FC920195 vs. ExPASy Swiss-Prot
Match: VDAC1_ORYSJ (Mitochondrial outer membrane protein porin OS=Oryza sativa subsp. japonica GN=VDAC1 PE=1 SV=3)

HSP 1 Score: 171.014 bits (432), Expect = 3.738e-42
Identity = 79/172 (45.93%), Postives = 119/172 (69.19%), Query Frame = 1
Query:   61 GPGLFADIGKKAKDLLTKDYNADQKISISTYSGAGVALTSTAVKKGGLSAGDVAAQYKYKNVLFDVKVDTESNILTTFTLTEILPSTKAIASLKVPDYNSGKLEVQYFHDHATFTSAIALNQSPCIDVTATIGTPSIAFGAEAGYDTTSGNFTKYTAGISVTKPDSCASIIL 576
            GPGL+ +IGKKA+DLL +DY  D K +++TY+  GVA+T+T+ KK  L  G++ +Q K KN+  DVK +++SN++TT T+ E+ P  K+I S  VPD  SGK E+QY HD+A  +++I L  SP +++++  GT ++A GA+   DT +GN TKY AG+S +  D  AS+ L
Sbjct:    3 GPGLYPEIGKKARDLLYRDYQTDHKFTLTTYTSNGVAITATSTKKADLIFGEIQSQIKNKNITVDVKANSDSNVVTTVTVDELTPGLKSILSFAVPDQRSGKFELQYSHDYAGVSASIGLTASPVVNLSSVFGTKALAVGADVSLDTATGNLTKYNAGLSFSNDDLIASLNL 174          
BLAST of FC920195 vs. ExPASy Swiss-Prot
Match: VDAC1_WHEAT (Mitochondrial outer membrane porin OS=Triticum aestivum GN=VDAC1 PE=2 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 6.597e-39
Identity = 76/173 (43.93%), Postives = 113/173 (65.32%), Query Frame = 1
Query:   61 GPGLFADIGKKAKDLLTKDYNADQKISISTYSGAGVALTSTAVKKGGLSAGDVAAQYKYKNVLFDVKVDTESNILTTFTLTEI-LPSTKAIASLKVPDYNSGKLEVQYFHDHATFTSAIALNQSPCIDVTATIGTPSIAFGAEAGYDTTSGNFTKYTAGISVTKPDSCASIIL 576
            GPGL++ IGKKAKDLL +DY  D K +++TY+  G A+T+T+ KK  L+ G++ +Q K KN+  DVK ++ SN++TT T  ++  P  K I S  VPD  SGK+E+QY HD+A   ++I L  +P ++++   GT ++A GA+   DT + NF KY A +S T  D  AS+ L
Sbjct:    3 GPGLYSGIGKKAKDLLYRDYQTDHKFTLTTYTANGPAITATSTKKADLTVGEIQSQIKNKNITVDVKANSASNVITTITADDLAAPGLKTILSFAVPDQKSGKVELQYLHDYAGINASIGLTANPVVNLSGAFGTSALAVGADVSLDTATKNFAKYNAALSYTNQDLIASLNL 175          
BLAST of FC920195 vs. ExPASy Swiss-Prot
Match: VDAC_MAIZE (Outer plastidial membrane protein porin OS=Zea mays GN=POR1 PE=2 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 2.594e-35
Identity = 72/171 (42.11%), Postives = 110/171 (64.33%), Query Frame = 1
Query:   67 GLFADIGKKAKDLLTKDYNADQKISISTYSGAGVALTSTAVKKGGLSAGDVAAQYKYKNVLFDVKVDTESNILTTFTLTEI-LPSTKAIASLKVPDYNSGKLEVQYFHDHATFTSAIALNQSPCIDVTATIGTPSIAFGAEAGYDTTSGNFTKYTAGISVTKPDSCASIIL 576
            GL+ DIGKK +DLL KDYN  QK  ++T S  GVA+T+   +K     G++  Q K K +  DVK ++ES++LTT T+ E   P  K+I +L VPD  SGKLE QY H++A   +++ LN +P ++++   G+ +++ G +  +DT + +FTKY A +S+T PD  AS+ L
Sbjct:    6 GLYTDIGKKTRDLLYKDYNTHQKFCLTTSSPNGVAITAAGTRKNESIFGELHTQIKNKKLTVDVKANSESDLLTTITVDEFGTPGLKSIINLVVPDQRSGKLEFQYLHEYAGVNASVGLNSNPMVNLSGAFGSKALSVGVDVSFDTATSDFTKYNAALSLTSPDLIASLHL 176          
The following BLAST results are available for this feature:
BLAST of FC920195 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 8
Match NameE-valueIdentityDescription
VDAC1_ARATH7.277e-4652.02Mitochondrial outer membrane protein porin 1 OS=Ar... [more]
VDAC_PEA1.621e-4550.29Outer plastidial membrane protein porin OS=Pisum s... [more]
VDAC2_ARATH4.717e-4548.57Mitochondrial outer membrane protein porin 2 OS=Ar... [more]
VDAC1_SOLTU4.717e-4550.86Mitochondrial outer membrane protein porin of 34 k... [more]
VDAC2_SOLTU4.415e-4348.00Mitochondrial outer membrane protein porin of 36 k... [more]
VDAC1_ORYSJ3.738e-4245.93Mitochondrial outer membrane protein porin OS=Oryz... [more]
VDAC1_WHEAT6.597e-3943.93Mitochondrial outer membrane porin OS=Triticum aes... [more]
VDAC_MAIZE2.594e-3542.11Outer plastidial membrane protein porin OS=Zea may... [more]
back to top
Libraries
Library NameType
RVDevelop1cdna_library
Properties
Property NameValue
Genbank descriptionC32005C03EF RVDevelop1 Citrus clementina cDNA clone C32005C03, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920195 ID=FC920195|Name=FC920195|organism=Citrus clementina|type=EST|length=580bp
GTCCCAAACTTCGCACAGATCCTTCACTTTCGTCTCTCTCACTAGTCAAC
CATGAGTAAGGGACCGGGGCTCTTCGCCGACATCGGTAAAAAAGCCAAAG
ATCTTTTGACGAAGGACTACAACGCCGATCAGAAAATCAGTATCTCCACT
TACAGCGGTGCCGGAGTGGCTCTCACATCAACTGCTGTGAAAAAGGGAGG
ACTCTCTGCTGGTGATGTTGCTGCACAGTACAAGTATAAGAATGTTTTAT
TCGATGTCAAAGTGGACACAGAGTCTAATATTTTGACAACCTTCACTCTT
ACTGAGATCCTTCCATCAACAAAGGCTATTGCTTCCTTGAAAGTGCCTGA
TTATAACTCTGGCAAGTTGGAGGTTCAGTACTTCCATGATCATGCCACCT
TTACTTCAGCCATTGCTTTGAATCAATCCCCTTGCATTGATGTTACAGCC
ACCATTGGTACCCCGAGCATTGCTTTTGGTGCTGAGGCTGGGTATGATAC
CACATCTGGTAATTTTACAAAGTACACAGCCGGCATTAGTGTGACCAAAC
CAGATTCATGTGCTTCAATAATTCTGGGTG
back to top