FC920196

Overview
NameFC920196
Unique NameFC920196
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length686
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15299 contig Ccv1_Contig15299:1..681. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920196 vs. ExPASy Swiss-Prot
Match: PSB7B_ARATH (Proteasome subunit beta type-7-B OS=Arabidopsis thaliana GN=PBB2 PE=1 SV=2)

HSP 1 Score: 328.946 bits (842), Expect = 1.492e-89
Identity = 157/185 (84.86%), Postives = 172/185 (92.97%), Query Frame = 2
Query:  131 MSNSAIDVPSRGGFSFDLCRRNDMLAKKGVNLPSFRKTGTTIVGLIFQDGVILGADTRATEGPIVCDKNCEKIHYMAPNIYCCGAGTAADTEAVTDMVSSQLQLHRYHTGRESRVVTALTLLKKHLFNYQGYVQAALVLGGVDCTGPHLHTIYPHGSTDTLPFANMGSGSLAAMAMFEIKXQEGL 685
            MS S++D+P +GGFSFDLC+RNDML +KG+  PSF KTGTTIVGLIF+DGVILGADTRATEGPIV DKNCEKIHYMAPNIYCCGAGTAADTEAVTDMVSSQL+LHRY TGR+SRVVTALTLLKKHLF+YQG+V AALVLGGVD TGPHLHTIYPHGSTDTLPFA MGSGSLAAM++FE K +EGL
Sbjct:    1 MSQSSVDIPPKGGFSFDLCKRNDMLTQKGLKAPSFLKTGTTIVGLIFKDGVILGADTRATEGPIVADKNCEKIHYMAPNIYCCGAGTAADTEAVTDMVSSQLRLHRYQTGRDSRVVTALTLLKKHLFSYQGHVSAALVLGGVDITGPHLHTIYPHGSTDTLPFATMGSGSLAAMSVFEAKYKEGL 185          
BLAST of FC920196 vs. ExPASy Swiss-Prot
Match: PSB7A_ARATH (Proteasome subunit beta type-7-A OS=Arabidopsis thaliana GN=PBB1 PE=1 SV=2)

HSP 1 Score: 328.561 bits (841), Expect = 1.948e-89
Identity = 157/185 (84.86%), Postives = 171/185 (92.43%), Query Frame = 2
Query:  131 MSNSAIDVPSRGGFSFDLCRRNDMLAKKGVNLPSFRKTGTTIVGLIFQDGVILGADTRATEGPIVCDKNCEKIHYMAPNIYCCGAGTAADTEAVTDMVSSQLQLHRYHTGRESRVVTALTLLKKHLFNYQGYVQAALVLGGVDCTGPHLHTIYPHGSTDTLPFANMGSGSLAAMAMFEIKXQEGL 685
            MS S +DVP +GGFSFDLC+RNDML +KG+  PSF KTGTTIVGLIF+DGVILGADTRATEGPIV DKNCEKIHYMAPNIYCCGAGTAADTEAVTDMVSSQL+LHRY TGR+SRV+TALTLLKKHLF+YQG+V AALVLGGVD TGPHLHTIYPHGSTDTLPFA MGSGSLAAM++FE K +EGL
Sbjct:    1 MSQSTVDVPPKGGFSFDLCKRNDMLTQKGLKAPSFLKTGTTIVGLIFKDGVILGADTRATEGPIVADKNCEKIHYMAPNIYCCGAGTAADTEAVTDMVSSQLRLHRYQTGRDSRVITALTLLKKHLFSYQGHVSAALVLGGVDITGPHLHTIYPHGSTDTLPFATMGSGSLAAMSVFEAKYKEGL 185          
BLAST of FC920196 vs. ExPASy Swiss-Prot
Match: PSB7_DICDI (Proteasome subunit beta type-7 OS=Dictyostelium discoideum GN=psmB7 PE=3 SV=1)

HSP 1 Score: 259.225 bits (661), Expect = 1.451e-68
Identity = 117/176 (66.48%), Postives = 148/176 (84.09%), Query Frame = 2
Query:  158 SRGGFSFDLCRRNDMLAKKGVNLPSFRKTGTTIVGLIFQDGVILGADTRATEGPIVCDKNCEKIHYMAPNIYCCGAGTAADTEAVTDMVSSQLQLHRYHTGRESRVVTALTLLKKHLFNYQGYVQAALVLGGVDCTGPHLHTIYPHGSTDTLPFANMGSGSLAAMAMFEIKXQEGL 685
            +RGGF FDLC RN++L K G+ +  F KTGTTIVG++++ GV+LGADTRATEGPIV DKNCEKIHY+A NIYCCGAGTAADTE+ T ++SS+L+LH+  TG+++RV+TALT+LK+ LF YQG++ AAL+LGG+D  GP LHTIYPHGSTD LP+  MGSGSLAAMA+FE K +  +
Sbjct:    5 NRGGFDFDLCNRNNVLEKTGLRMKGFMKTGTTIVGVVYKGGVVLGADTRATEGPIVADKNCEKIHYIADNIYCCGAGTAADTESATALISSKLKLHKLSTGKQTRVITALTMLKQMLFKYQGHISAALILGGIDINGPSLHTIYPHGSTDQLPYVTMGSGSLAAMAVFEAKYKNDM 180          
BLAST of FC920196 vs. ExPASy Swiss-Prot
Match: PSB7_HUMAN (Proteasome subunit beta type-7 OS=Homo sapiens GN=PSMB7 PE=1 SV=1)

HSP 1 Score: 248.054 bits (632), Expect = 3.346e-65
Identity = 119/184 (64.67%), Postives = 145/184 (78.80%), Query Frame = 2
Query:  131 MSNSAIDVPSRGGFSFDLCRRNDML----AKKGVNLPSFRKTGTTIVGLIFQDGVILGADTRATEGPIVCDKNCEKIHYMAPNIYCCGAGTAADTEAVTDMVSSQLQLHRYHTGRESRVVTALTLLKKHLFNYQGYVQAALVLGGVDCTGPHLHTIYPHGSTDTLPFANMGSGSLAAMAMFEIK 670
            M+  ++  P  GGFSFD CRRN +L    AK+G  LP  RKTGTTI G++++DG++LGADTRATEG +V DKNC KIH+++PNIYCCGAGTAADT+  T ++SS L+LH   TGR  RVVTA  +LK+ LF YQGY+ AALVLGGVD TGPHL++IYPHGSTD LP+  MGSGSLAAMA+FE K
Sbjct:    1 MAAVSVYAPPVGGFSFDNCRRNAVLEADFAKRGYKLPKVRKTGTTIAGVVYKDGIVLGADTRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLSTGRLPRVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDK 184          
BLAST of FC920196 vs. ExPASy Swiss-Prot
Match: PSB7_MOUSE (Proteasome subunit beta type-7 OS=Mus musculus GN=Psmb7 PE=1 SV=1)

HSP 1 Score: 247.669 bits (631), Expect = 4.370e-65
Identity = 120/184 (65.22%), Postives = 145/184 (78.80%), Query Frame = 2
Query:  131 MSNSAIDVPSRGGFSFDLCRRNDML----AKKGVNLPSFRKTGTTIVGLIFQDGVILGADTRATEGPIVCDKNCEKIHYMAPNIYCCGAGTAADTEAVTDMVSSQLQLHRYHTGRESRVVTALTLLKKHLFNYQGYVQAALVLGGVDCTGPHLHTIYPHGSTDTLPFANMGSGSLAAMAMFEIK 670
            M+  ++  P  GGFSFD CRRN +L    AKKG  LP  RKTGTTI G++++DG++LGADTRATEG +V DKNC KIH+++PNIYCCGAGTAADT+  T ++SS L+LH   TGR  RVVTA  +LK+ LF YQGY+ AALVLGGVD TGPHL++IYPHGSTD LP+  MGSGSLAAMA+FE K
Sbjct:    1 MAAVSVFQPPVGGFSFDNCRRNAVLEADFAKKGFKLPKARKTGTTIAGVVYKDGIVLGADTRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLTTGRLPRVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDK 184          
BLAST of FC920196 vs. ExPASy Swiss-Prot
Match: PSB7_PIG (Proteasome subunit beta type-7 OS=Sus scrofa GN=PSMB7 PE=2 SV=2)

HSP 1 Score: 247.284 bits (630), Expect = 5.707e-65
Identity = 121/183 (66.12%), Postives = 146/183 (79.78%), Query Frame = 2
Query:  140 SAIDVPSR--GGFSFDLCRRNDML----AKKGVNLPSFRKTGTTIVGLIFQDGVILGADTRATEGPIVCDKNCEKIHYMAPNIYCCGAGTAADTEAVTDMVSSQLQLHRYHTGRESRVVTALTLLKKHLFNYQGYVQAALVLGGVDCTGPHLHTIYPHGSTDTLPFANMGSGSLAAMAMFEIK 670
            +A+ V  R  GGFSFD CRRN +L    AKKG  LP+ RKTGTTI G++++DG++LGADTRATEG +V DKNC KIH+++PNIYCCGAGTAADT+  T ++SS L+LH   TGR  RVVTA  +LK+ LF YQGY+ AALVLGGVD TGPHL++IYPHGSTD LP+  MGSGSLAAMA+FE K
Sbjct:    2 AAVSVYERPVGGFSFDNCRRNAILEADFAKKGYKLPTARKTGTTIAGVVYKDGIVLGADTRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLSTGRLPRVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDK 184          
BLAST of FC920196 vs. ExPASy Swiss-Prot
Match: PSB7_BOVIN (Proteasome subunit beta type-7 OS=Bos taurus GN=PSMB7 PE=1 SV=1)

HSP 1 Score: 247.284 bits (630), Expect = 5.707e-65
Identity = 121/183 (66.12%), Postives = 146/183 (79.78%), Query Frame = 2
Query:  140 SAIDVPSR--GGFSFDLCRRNDML----AKKGVNLPSFRKTGTTIVGLIFQDGVILGADTRATEGPIVCDKNCEKIHYMAPNIYCCGAGTAADTEAVTDMVSSQLQLHRYHTGRESRVVTALTLLKKHLFNYQGYVQAALVLGGVDCTGPHLHTIYPHGSTDTLPFANMGSGSLAAMAMFEIK 670
            +A+ V  R  GGFSFD CRRN +L    AKKG  LP+ RKTGTTI G++++DG++LGADTRATEG +V DKNC KIH+++PNIYCCGAGTAADT+  T ++SS L+LH   TGR  RVVTA  +LK+ LF YQGY+ AALVLGGVD TGPHL++IYPHGSTD LP+  MGSGSLAAMA+FE K
Sbjct:    2 AAVSVYERPVGGFSFDNCRRNAVLEADFAKKGYKLPTARKTGTTIAGVVYKDGIVLGADTRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLSTGRLPRVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDK 184          
BLAST of FC920196 vs. ExPASy Swiss-Prot
Match: PSB7_RAT (Proteasome subunit beta type-7 OS=Rattus norvegicus GN=Psmb7 PE=1 SV=1)

HSP 1 Score: 246.128 bits (627), Expect = 1.271e-64
Identity = 118/173 (68.21%), Postives = 140/173 (80.92%), Query Frame = 2
Query:  164 GGFSFDLCRRNDML----AKKGVNLPSFRKTGTTIVGLIFQDGVILGADTRATEGPIVCDKNCEKIHYMAPNIYCCGAGTAADTEAVTDMVSSQLQLHRYHTGRESRVVTALTLLKKHLFNYQGYVQAALVLGGVDCTGPHLHTIYPHGSTDTLPFANMGSGSLAAMAMFEIK 670
            GGFSFD CRRN +L    AKKG  LP  RKTGTTI G++++DG++LGADTRATEG +V DKNC KIH+++PNIYCCGAGTAADT+  T ++SS L+LH   TGR  RVVTA  +LK+ LF YQGY+ AALVLGGVD TGPHL++IYPHGSTD LP+  MGSGSLAAMA+FE K
Sbjct:   12 GGFSFDNCRRNAVLEADFAKKGFKLPKARKTGTTIAGVVYKDGIVLGADTRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLTTGRLPRVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDK 184          
BLAST of FC920196 vs. ExPASy Swiss-Prot
Match: PSB7_SCHPO (Probable proteasome subunit beta type-7 OS=Schizosaccharomyces pombe GN=SPAC23D3.07 PE=2 SV=1)

HSP 1 Score: 218.779 bits (556), Expect = 2.174e-56
Identity = 104/178 (58.43%), Postives = 134/178 (75.28%), Query Frame = 2
Query:  152 VPSRGGFSFDLCRRNDMLAKKGVNLPSFRKTGTTIVGLIFQDGVILGADTRATEGPIVCDKNCEKIHYMAPNIYCCGAGTAADTEAVTDMVSSQLQLHRYHTGRESRVVTALTLLKKHLFNYQGYVQAALVLGGVDCTGPHLHTIYPHGSTDTLPFANMGSGSLAAMAMFEIKXQEGL 685
            +  R GF F+  +RN +L +KG   P    TGTTIVG+I +D ++LGADTRAT GPI+ DKNC+K+H ++PNI+C GAGTAADTE VT M+SS ++LH  +T R+ RVVTALT+LK+HLF YQG++ A LVLGG DC GPHL TI  HGS+D LP+  +GSGSLAA+++ E K Q  L
Sbjct:    4 INERKGFDFEYYQRNLLLQEKGFPTPKATSTGTTIVGVIAKDCIVLGADTRATAGPIIADKNCKKLHLISPNIWCAGAGTAADTEFVTSMISSNIELHSLYTNRKPRVVTALTMLKQHLFRYQGHIGAYLVLGGYDCKGPHLFTIAAHGSSDKLPYVALGSGSLAAISVLETKYQPDL 181          
BLAST of FC920196 vs. ExPASy Swiss-Prot
Match: PSB10_HUMAN (Proteasome subunit beta type-10 OS=Homo sapiens GN=PSMB10 PE=1 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 5.920e-54
Identity = 101/177 (57.06%), Postives = 130/177 (73.45%), Query Frame = 2
Query:  161 RGGFSFDLCRRNDMLAK--KGVNLPSFRKTGTTIVGLIFQDGVILGADTRATEGPIVCDKNCEKIHYMAPNIYCCGAGTAADTEAVTDMVSSQLQLHRYHTGRESRVVTALTLLKKHLFNYQGYVQAALVLGGVDCTGPHLHTIYPHGSTDTLPFANMGSGSLAAMAMFEIKXQEGL 685
            RGGFSF+ C+RN  L +   G+ +P  RKTGTTI GL+FQDGVILGADTRAT   +V DK+CEKIH++AP IYCCGAG AAD E  T MV+S+++LH   TGRE RV T   +L++ LF YQG+V A+L++GGVD TGP L+ ++PHGS   LPF  +GSG  AA+A+ E + Q  +
Sbjct:    9 RGGFSFENCQRNASLERVLPGLKVPHARKTGTTIAGLVFQDGVILGADTRATNDSVVADKSCEKIHFIAPKIYCCGAGVAADAEMTTRMVASKMELHALSTGREPRVATVTRILRQTLFRYQGHVGASLIVGGVDLTGPQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDRFQPNM 185          
The following BLAST results are available for this feature:
BLAST of FC920196 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 41
Match NameE-valueIdentityDescription
PSB7B_ARATH1.492e-8984.86Proteasome subunit beta type-7-B OS=Arabidopsis th... [more]
PSB7A_ARATH1.948e-8984.86Proteasome subunit beta type-7-A OS=Arabidopsis th... [more]
PSB7_DICDI1.451e-6866.48Proteasome subunit beta type-7 OS=Dictyostelium di... [more]
PSB7_HUMAN3.346e-6564.67Proteasome subunit beta type-7 OS=Homo sapiens GN=... [more]
PSB7_MOUSE4.370e-6565.22Proteasome subunit beta type-7 OS=Mus musculus GN=... [more]
PSB7_PIG5.707e-6566.12Proteasome subunit beta type-7 OS=Sus scrofa GN=PS... [more]
PSB7_BOVIN5.707e-6566.12Proteasome subunit beta type-7 OS=Bos taurus GN=PS... [more]
PSB7_RAT1.271e-6468.21Proteasome subunit beta type-7 OS=Rattus norvegicu... [more]
PSB7_SCHPO2.174e-5658.43Probable proteasome subunit beta type-7 OS=Schizos... [more]
PSB10_HUMAN5.920e-5457.06Proteasome subunit beta type-10 OS=Homo sapiens GN... [more]

Pages

back to top
Libraries
Library NameType
RVDevelop1cdna_library
Properties
Property NameValue
Genbank descriptionC32005C04EF RVDevelop1 Citrus clementina cDNA clone C32005C04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920196 ID=FC920196|Name=FC920196|organism=Citrus clementina|type=EST|length=686bp
CTTGCCGGGGATCCTTTCTTTCGTTTTAAGTTTCTAAGACTCGAAGTCGC
TCGCTGTCGCTGCTGCTCTCCAAAGCTCACGCCTTGTTTTCATTCCAGTG
GGATCAATCTCAGGTTGAAGAAAGTTTAAAATGTCAAACTCTGCAATAGA
TGTTCCTTCCAGGGGTGGATTTAGTTTTGATCTCTGCCGGCGGAATGATA
TGCTTGCAAAGAAGGGTGTCAACCTTCCATCTTTCCGAAAGACGGGGACG
ACCATTGTTGGGTTGATTTTCCAGGATGGCGTCATTCTTGGGGCAGATAC
CAGAGCAACTGAAGGACCCATAGTTTGCGATAAGAATTGTGAGAAAATTC
ATTACATGGCTCCAAACATATATTGTTGTGGTGCAGGAACTGCTGCTGAC
ACAGAGGCTGTAACTGACATGGTCAGCTCACAGCTGCAGTTACATCGTTA
TCATACTGGTAGAGAGTCAAGGGTTGTTACAGCACTGACTCTTCTCAAGA
AGCACCTTTTCAACTACCAAGGTTATGTGCAAGCTGCTTTGGTTCTTGGT
GGAGTTGATTGCACTGGACCTCATCTTCACACAATATATCCACATGGTTC
AACTGACACTTTACCATTTGCGAACATGGGTTCTGGTTCTCTTGCTGCCA
TGGCTATGTTTGAAATCAAATANCAAGAAGGCCTGA
back to top