FC920197

Overview
NameFC920197
Unique NameFC920197
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length729
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig8398 contig Ccv1_Contig8398:84..813. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920197 vs. ExPASy Swiss-Prot
Match: MINP1_MOUSE (Multiple inositol polyphosphate phosphatase 1 OS=Mus musculus GN=Minpp1 PE=1 SV=2)

HSP 1 Score: 71.2478 bits (173), Expect = 6.262e-12
Identity = 45/130 (34.62%), Postives = 72/130 (55.38%), Query Frame = 1
Query:  295 PSEIPDGCTPIHLNLVARHGTRAPTKKRMRELERLADHLEVLIREAKEKGSSLQKVPGWLQGWKSPWQGKLKGGELISKGEDELYDLGIRIREKYPDLFSEEYHPDVYPIKATQVPRASASAVAFGMGLF 684
            P  +   CTP+ L  + RHGTR PT K++R+L++L   L+   RE+++ GS   +V   L  W   W G    G+L+ KG  ++  L +R+   +PDLFS E +  +  I +++  R   S+ AF  GL+
Sbjct:   71 PELLAGTCTPVQLVALIRHGTRYPTTKQIRKLKQLQGLLQT--RESRDGGS---QVAAALAEWPL-WYGDWMDGQLVEKGRQDMRQLALRLAALFPDLFSRENYDRLRLITSSK-HRCVDSSAAFLQGLW 193          
The following BLAST results are available for this feature:
BLAST of FC920197 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
MINP1_MOUSE6.262e-1234.62Multiple inositol polyphosphate phosphatase 1 OS=M... [more]
back to top
Libraries
Library NameType
RVDevelop1cdna_library
Properties
Property NameValue
Genbank descriptionC32005C05EF RVDevelop1 Citrus clementina cDNA clone C32005C05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920197 ID=FC920197|Name=FC920197|organism=Citrus clementina|type=EST|length=729bp
GGCTACAAATCAATCGTCAATCTCTCCCCGATTGTATAAGCACTGTAGTT
ACCGACACACCGAATCTTACTCGTTCGTGAGCGGAGCGTCTAAGCTGAGA
AATTATTTCATCATCAAAGCACAAAACCAGAGACGGTGAAAATGAAGAAA
GCTACGGCTTCTTTTATGTTGATCCTGTGCGTACTTTTGTTGACGCATCT
AAACGACGCCGTTCAAAATTTCGACGTTCGACGGCACCTCTCGACTGTCT
CAAGATACGACTTCGTAAAAGACGTCGTTGATAAGAACTTTGTACCTTCT
GAAATTCCCGATGGATGTACTCCAATTCACTTAAATCTTGTGGCAAGGCA
CGGGACTCGTGCACCCACGAAGAAACGGATGAGGGAGTTGGAAAGATTGG
CTGATCATTTGGAAGTACTTATAAGGGAAGCCAAAGAAAAGGGTTCGTCT
TTACAGAAAGTTCCGGGCTGGTTACAGGGATGGAAGTCTCCCTGGCAAGG
GAAACTGAAGGGTGGTGAATTGATTAGCAAAGGAGAAGATGAGTTATATG
ATCTCGGAATCAGGATTAGAGAAAAATATCCAGATTTGTTTAGCGAGGAA
TATCACCCGGATGTCTATCCCATTAAGGCTACTCAGGTTCCTCGCGCATC
TGCGAGTGCAGTAGCATTTGGCATGGGGCTCTTTACGAGAGAGGGACTCT
AGGACCTGGGCGCCATCGAGCATTTGCTG
back to top