FC920377

Overview
NameFC920377
Unique NameFC920377
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length491
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig12500 contig Ccv1_Contig12500:83..574. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920377 vs. ExPASy Swiss-Prot
Match: UFOG_PETHY (Anthocyanidin 3-O-glucosyltransferase OS=Petunia hybrida GN=RT PE=2 SV=1)

HSP 1 Score: 202.216 bits (513), Expect = 1.028e-51
Identity = 102/151 (67.55%), Postives = 117/151 (77.48%), Query Frame = 2
Query:   17 DQLHVVMFPWFAFGHISPFVQLSNKLSLHGVKVSFFSAPGNIPRIKSSLNLTPMADIIPLQIPHVDGLPPGLDSTSEMTPHMAELLKQALDLMQPQIKTLLSQLKPHFVFFDFTHYWLPGLVGSQLGIKTRNFSVFSAISQAYLVVPARKL 469
            D LHVVMFP+FAFGHISPFVQL+NKLS +GVKVSFF+A GN  R+KS LN  P   I+PL +PHV+GLPPG +ST+E+TP  AELLK ALDLMQPQIKTLLS LKPHFV FDF   WLP +    LGIKT  +SV  A+S A+L  PAR L
Sbjct:   10 DALHVVMFPFFAFGHISPFVQLANKLSSYGVKVSFFTASGNASRVKSMLNSAPTTHIVPLTLPHVEGLPPGAESTAELTPASAELLKVALDLMQPQIKTLLSHLKPHFVLFDFAQEWLPKMANG-LGIKTVYYSVVVALSTAFLTCPARVL 159          
The following BLAST results are available for this feature:
BLAST of FC920377 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
UFOG_PETHY1.028e-5167.55Anthocyanidin 3-O-glucosyltransferase OS=Petunia h... [more]
back to top
Properties
Property NameValue
Genbank descriptionC32007E10EF RVDevelop1 Citrus clementina cDNA clone C32007E10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920377 ID=FC920377|Name=FC920377|organism=Citrus clementina|type=EST|length=491bp
TGAATCAGCTGAAGCTGATCAACTTCACGTGGTGATGTTCCCATGGTTTG
CTTTTGGTCACATAAGCCCCTTTGTACAACTTTCCAACAAGCTCTCACTT
CATGGAGTCAAGGTCTCTTTCTTTTCGGCTCCTGGTAACATTCCCCGCAT
CAAATCATCGCTCAATTTAACTCCCATGGCCGACATTATCCCTCTTCAAA
TCCCACACGTCGATGGCCTCCCTCCTGGTCTTGATAGCACCTCAGAGATG
ACACCTCACATGGCTGAGCTCCTAAAGCAAGCCTTGGACCTCATGCAACC
ACAAATCAAAACTTTGTTGTCGCAGCTCAAACCACATTTTGTGTTCTTTG
ATTTTACCCATTACTGGTTGCCGGGTCTTGTTGGTTCTCAACTTGGCATC
AAAACCCGTAACTTCTCTGTTTTCTCTGCCATTTCACAAGCCTATCTCGT
GGTCCCCGCCAGGAAACTCACAACAGTTTAGCAGATCTAAT
back to top