FC920379

Overview
NameFC920379
Unique NameFC920379
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length626
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig12749 contig Ccv1_Contig12749:145..771. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920379 vs. ExPASy Swiss-Prot
Match: MTL10_HUMAN (Methyltransferase-like protein 10 OS=Homo sapiens GN=METTL10 PE=1 SV=2)

HSP 1 Score: 88.9669 bits (219), Expect = 2.178e-17
Identity = 49/131 (37.40%), Postives = 69/131 (52.67%), Query Frame = 1
Query:  220 SDKEEPDPEGMA-SMLGLQSYWDSAYADELANFREHGHAGEVWFGADVMDVVASWTKSLCISISQGHMLNHVEDLKSEPVEENDKYLSSWSVLDIGTGNGLLLQELSKQGFSDLTGVDYSEDXINLAQALL 609
            SDK  P  +G   S LG + +WD+ Y  EL  FRE+G  GE+WFG + M+ +  W +   I +                           SVLDIGTGNG+ L EL+K GFS++TG+DYS   I L+ +++
Sbjct:   17 SDKGSPGEDGFVPSALGTREHWDAVYERELQTFREYGDTGEIWFGEESMNRLIRWMQKHKIPLDA-------------------------SVLDIGTGNGVFLVELAKFGFSNITGIDYSPSAIQLSGSII 122          
BLAST of FC920379 vs. ExPASy Swiss-Prot
Match: MTL10_DANRE (Methyltransferase-like protein 10 OS=Danio rerio GN=mettl10 PE=2 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 7.006e-16
Identity = 43/119 (36.13%), Postives = 65/119 (54.62%), Query Frame = 1
Query:  256 SMLGLQSYWDSAYADELANFREHGHAGEVWFGADVMDVVASWTKSLCISISQGHMLNHVEDLKSEPVEENDKYLSSWSVLDIGTGNGLLLQELSKQGFSDLTGVDYSEDXINLAQALLI 612
            S LG + YWD AY  EL  +++ G  GE+WFG + M  V  W                   ++++ + EN       ++LDIGTGNG+ L EL++ GFS+LTG+DYS+  + L   +L+
Sbjct:   26 SKLGTKEYWDGAYKRELQTYKDIGDVGEIWFGEESMHRVIRW-------------------MEAQNISENA------AILDIGTGNGMFLVELARHGFSNLTGIDYSKAALELTTNILV 119          
BLAST of FC920379 vs. ExPASy Swiss-Prot
Match: MTL10_MOUSE (Methyltransferase-like protein 10 OS=Mus musculus GN=Mettl10 PE=2 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 1.195e-15
Identity = 44/118 (37.29%), Postives = 62/118 (52.54%), Query Frame = 1
Query:  256 SMLGLQSYWDSAYADELANFREHGHAGEVWFGADVMDVVASWTKSLCISISQGHMLNHVEDLKSEPVEENDKYLSSWSVLDIGTGNGLLLQELSKQGFSDLTGVDYSEDXINLAQALL 609
            S LG + +WD+ Y  EL  F+E+G  GE+WFG + M+ +  W +   I +                           SVLDIGTGNG+ L EL K GFS++TG+DYS   I L+ ++L
Sbjct:   30 SALGTREHWDAVYERELRTFQEYGDTGEIWFGEESMNRLIRWMQKHKIPLDA-------------------------SVLDIGTGNGVFLVELVKHGFSNITGIDYSPSAIKLSASIL 122          
The following BLAST results are available for this feature:
BLAST of FC920379 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
MTL10_HUMAN2.178e-1737.40Methyltransferase-like protein 10 OS=Homo sapiens ... [more]
MTL10_DANRE7.006e-1636.13Methyltransferase-like protein 10 OS=Danio rerio G... [more]
MTL10_MOUSE1.195e-1537.29Methyltransferase-like protein 10 OS=Mus musculus ... [more]
back to top
Properties
Property NameValue
Genbank descriptionC32007E12EF RVDevelop1 Citrus clementina cDNA clone C32007E12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920379 ID=FC920379|Name=FC920379|organism=Citrus clementina|type=EST|length=626bp
CGATTGCCGCCGGAAGAACCCGAGGTTTCGCCGCAACAGCCGCCGCAGCA
GGTCCGCGTCGCGGGCGATCTAGTGTCTGACGACGAGCGGTCAGTCGCTG
CGGACTCGTGGTCAATAAAGAGCGAGTATGGAAGCACTCTCGACGATGAT
CAGCGCCACGCCGATGCCGCTGAGGCCCTCTCCTCCGCCGCAAACTTCCG
CGCTAATTCTGATTACAATTCTGACAAGGAGGAGCCAGATCCAGAAGGGA
TGGCATCAATGTTAGGTCTTCAGAGTTACTGGGATTCTGCTTACGCAGAT
GAGTTGGCTAATTTTCGTGAACATGGCCATGCTGGTGAAGTTTGGTTTGG
AGCTGATGTCATGGATGTTGTTGCTTCTTGGACAAAAAGCTTGTGCATTA
GCATATCACAAGGTCACATGCTGAATCATGTTGAAGATCTTAAGTCTGAG
CCTGTGGAAGAGAATGATAAGTATTTGTCTTCTTGGAGTGTACTTGATAT
TGGTACTGGCAATGGTCTGCTTCTTCAAGAACTTTCCAAGCAGGGGTTCT
CTGATTTAACTGGAGTTGATTATAGTGAAGATGNCATAAACCTTGCTCAA
GCCTTGCTAATCGTGATGGATTTTCC
back to top