FC920380

Overview
NameFC920380
Unique NameFC920380
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length691
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig2223 contig Ccv1_Contig2223:1278..1968. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920380 vs. ExPASy Swiss-Prot
Match: PSD10_RAT (26S proteasome non-ATPase regulatory subunit 10 OS=Rattus norvegicus GN=Psmd10 PE=2 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 1.225e-22
Identity = 58/126 (46.03%), Postives = 76/126 (60.32%), Query Frame = 2
Query:  287 NDDDRTLLHVAASCGHPEVVEILLSVDESANVVNAVDEEGWAPIHSAASIGNVTIVEMLLSKGADVNLKNDGGRTALHYAASKGWLKIVELLISRGAKINSKDKVGCTALHRGASTGNSALCELLI 664
            + D RT LH A S GH E+VE LL +      VN  D+ GW+P+H AAS G   IV+ LL KGA VN  N  G TALHYAASK   +I  +L+  GA  ++K+    TA+HR A+ GN  +  +L+
Sbjct:   37 DQDSRTALHWACSAGHTEIVEFLLQLGVP---VNEKDDAGWSPLHIAASAGRDEIVKALLIKGAQVNAVNQNGCTALHYAASKNRHEIAVMLLEGGANPDAKNHYDATAMHRAAAKGNLKMVHILL 159          

HSP 2 Score: 80.8777 bits (198), Expect = 7.198e-15
Identity = 44/114 (38.60%), Postives = 66/114 (57.89%), Query Frame = 2
Query:  347 EILLSVDESANVVNAVDEEGWAPIHSAASIGNVTIVEMLLSKGADVNLKNDGGRTALHYAASKGWLKIVELLISRGAKINSKDKVGCTALHRGASTGNSALCELLIEEGAEVDA 688
            E+  S+    ++    D++    +H A S G+  IVE LL  G  VN K+D G + LH AAS G  +IV+ L+ +GA++N+ ++ GCTALH  AS     +  +L+E GA  DA
Sbjct:   21 ELKESILADKSLATRTDQDSRTALHWACSAGHTEIVEFLLQLGVPVNEKDDAGWSPLHIAASAGRDEIVKALLIKGAQVNAVNQNGCTALHYAASKNRHEIAVMLLEGGANPDA 134          
BLAST of FC920380 vs. ExPASy Swiss-Prot
Match: PSD10_HUMAN (26S proteasome non-ATPase regulatory subunit 10 OS=Homo sapiens GN=PSMD10 PE=1 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 1.225e-22
Identity = 58/126 (46.03%), Postives = 75/126 (59.52%), Query Frame = 2
Query:  287 NDDDRTLLHVAASCGHPEVVEILLSVDESANVVNAVDEEGWAPIHSAASIGNVTIVEMLLSKGADVNLKNDGGRTALHYAASKGWLKIVELLISRGAKINSKDKVGCTALHRGASTGNSALCELLI 664
            + D RT LH A S GH E+VE LL +      VN  D+ GW+P+H AAS G   IV+ LL KGA VN  N  G T LHYAASK   +I  +L+  GA  ++KD    TA+HR A+ GN  +  +L+
Sbjct:   37 DQDSRTALHWACSAGHTEIVEFLLQLGVP---VNDKDDAGWSPLHIAASAGRDEIVKALLGKGAQVNAVNQNGCTPLHYAASKNRHEIAVMLLEGGANPDAKDHYEATAMHRAAAKGNLKMIHILL 159          

HSP 2 Score: 79.337 bits (194), Expect = 2.094e-14
Identity = 43/114 (37.72%), Postives = 65/114 (57.02%), Query Frame = 2
Query:  347 EILLSVDESANVVNAVDEEGWAPIHSAASIGNVTIVEMLLSKGADVNLKNDGGRTALHYAASKGWLKIVELLISRGAKINSKDKVGCTALHRGASTGNSALCELLIEEGAEVDA 688
            E+  S+    ++    D++    +H A S G+  IVE LL  G  VN K+D G + LH AAS G  +IV+ L+ +GA++N+ ++ GCT LH  AS     +  +L+E GA  DA
Sbjct:   21 ELKESILADKSLATRTDQDSRTALHWACSAGHTEIVEFLLQLGVPVNDKDDAGWSPLHIAASAGRDEIVKALLGKGAQVNAVNQNGCTPLHYAASKNRHEIAVMLLEGGANPDA 134          
BLAST of FC920380 vs. ExPASy Swiss-Prot
Match: PSD10_MOUSE (26S proteasome non-ATPase regulatory subunit 10 OS=Mus musculus GN=Psmd10 PE=1 SV=2)

HSP 1 Score: 105.916 bits (263), Expect = 2.089e-22
Identity = 58/126 (46.03%), Postives = 75/126 (59.52%), Query Frame = 2
Query:  287 NDDDRTLLHVAASCGHPEVVEILLSVDESANVVNAVDEEGWAPIHSAASIGNVTIVEMLLSKGADVNLKNDGGRTALHYAASKGWLKIVELLISRGAKINSKDKVGCTALHRGASTGNSALCELLI 664
            + D RT LH A S GH E+VE LL +      VN  D+ GW+P+H AAS G   IV+ LL KGA VN  N  G T LHYAASK   +I  +L+  GA  ++KD    TA+HR A+ GN  +  +L+
Sbjct:   37 DQDSRTALHWACSAGHTEIVEFLLQLGVP---VNDKDDAGWSPLHIAASAGRDEIVKALLVKGAHVNAVNQNGCTPLHYAASKNRHEIAVMLLEGGANPDAKDHYDATAMHRAAAKGNLKMVHILL 159          

HSP 2 Score: 76.6406 bits (187), Expect = 1.357e-13
Identity = 41/104 (39.42%), Postives = 60/104 (57.69%), Query Frame = 2
Query:  377 NVVNAVDEEGWAPIHSAASIGNVTIVEMLLSKGADVNLKNDGGRTALHYAASKGWLKIVELLISRGAKINSKDKVGCTALHRGASTGNSALCELLIEEGAEVDA 688
            ++    D++    +H A S G+  IVE LL  G  VN K+D G + LH AAS G  +IV+ L+ +GA +N+ ++ GCT LH  AS     +  +L+E GA  DA
Sbjct:   31 SLATRTDQDSRTALHWACSAGHTEIVEFLLQLGVPVNDKDDAGWSPLHIAASAGRDEIVKALLVKGAHVNAVNQNGCTPLHYAASKNRHEIAVMLLEGGANPDA 134          
BLAST of FC920380 vs. ExPASy Swiss-Prot
Match: PSD10_DICDI (26S proteasome non-ATPase regulatory subunit 10 OS=Dictyostelium discoideum GN=psmD10 PE=2 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 2.310e-21
Identity = 58/136 (42.65%), Postives = 83/136 (61.03%), Query Frame = 2
Query:  284 RNDDDRTLLHVAASCGHPEVVEILLSVDESANVVNAVDEEGWAPIHSAASIGNVTIVEMLLSKGADVNLKNDGGRTALHYAASKGWLKIVELLISRGAKINSKDKVGCTALHRGASTGNSALCELLIEEGAEVDAT 691
            +++D+RT LH AA+ G   V + L+  D      N  D+ GW P+ SA S G+  +V++LL  GAD N  ND  RT LHYA+SKG   IV+LL++ GAK N KD  G   +HR +S G+ A  E L++  A +++T
Sbjct:   42 KDEDERTPLHWAAAKGQISVAQYLM--DNCKCSPNTNDDGGWTPLTSATSAGHTHMVKLLLEFGADPNTVNDSKRTPLHYASSKGRSDIVDLLLTHGAK-NRKDDTGSAPIHRASSNGSVATVERLLKGEANINST 174          
BLAST of FC920380 vs. ExPASy Swiss-Prot
Match: Y381_RICFE (Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis GN=RF_0381 PE=4 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 1.268e-19
Identity = 51/135 (37.78%), Postives = 77/135 (57.04%), Query Frame = 2
Query:  284 RNDDDRTLLHVAASCGHPEVVEILLSVDESANVVNAVDEEGWAPIHSAASIGNVTIVEMLLSKGADVNLKNDGGRTALHYAASKGWLKIVELLISRGAKINSKDKVGCTALHRGASTGNSALCELLIEEGAEVDA 688
            + +   T+LH AA  G+  +V +L+    +   +N   ++G   +H A   GN+ +V +L+ KG DVN K + G T LH+A   G L +V LL+ RGA +N+K   G TALH    + N AL  LL+  GA+V+A
Sbjct:  960 KTNSGETILHFAAESGNLNLVSLLI---HNGTDINTKTDDGLTALHYAVESGNLNLVSLLIHKGIDVNAKTNSGETILHFAVDLGSLDLVSLLMVRGADVNAKTDDGLTALHYAVESDNLALVSLLMVYGADVNA 1091          

HSP 2 Score: 92.4337 bits (228), Expect = 2.391e-18
Identity = 55/135 (40.74%), Postives = 78/135 (57.78%), Query Frame = 2
Query:  284 RNDDDRTLLHVAASCGHPEVVEILLSVDESANVVNAVDEEGWAPIHSAASIGNVTIVEMLLSKGADVNLKNDGGRTALHYAASKGWLKIVELLISRGAKINSKDKVGCTALHRGASTGNSALCELLIEEGAEVDA 688
            + D+  T+LH A   G+  +V+ L  ++  AN+ +A  + G   +H A S  N  +V +L++ GADVN K D G TALHYA   G L +V LLIS GA +N+K   G T L+     G+  L  LLI  GA+V+A
Sbjct:  667 KTDNGETVLHYAVKSGNLHLVKWL--IENQANI-HAKTDNGETVLHYAVSFNNSDLVYLLIAYGADVNAKTDNGLTALHYAVYDGNLDLVSLLISHGADVNAKTNSGETILYSAVDYGSPDLVYLLIAYGADVNA 798          

HSP 3 Score: 89.7373 bits (221), Expect = 1.549e-17
Identity = 50/135 (37.04%), Postives = 74/135 (54.81%), Query Frame = 2
Query:  284 RNDDDRTLLHVAASCGHPEVVEILLSVDESANVVNAVDEEGWAPIHSAASIGNVTIVEMLLSKGADVNLKNDGGRTALHYAASKGWLKIVELLISRGAKINSKDKVGCTALHRGASTGNSALCELLIEEGAEVDA 688
            + +   T+LH AA  G+  +V  L+   ++   ++A    G   +H AA  GN+ +V +L+  G D+N K D G TALHYA   G L +V LLI +G  +N+K   G T LH     G+  L  LL+  GA+V+A
Sbjct:  927 KTNSGETILHFAAKSGNLNLVNWLI---KNKADIHAKTNSGETILHFAAESGNLNLVSLLIHNGTDINTKTDDGLTALHYAVESGNLNLVSLLIHKGIDVNAKTNSGETILHFAVDLGSLDLVSLLMVRGADVNA 1058          

HSP 4 Score: 88.5817 bits (218), Expect = 3.452e-17
Identity = 50/135 (37.04%), Postives = 74/135 (54.81%), Query Frame = 2
Query:  284 RNDDDRTLLHVAASCGHPEVVEILLSVDESANVVNAVDEEGWAPIHSAASIGNVTIVEMLLSKGADVNLKNDGGRTALHYAASKGWLKIVELLISRGAKINSKDKVGCTALHRGASTGNSALCELLIEEGAEVDA 688
            + +   T+LH AA  G+  +V  L+   ++   ++A    G   +H AA  GN+ +V  L+   AD++ K + G T LH+AA  G L +V LLI  G  IN+K   G TALH    +GN  L  LLI +G +V+A
Sbjct:  894 KTNSGETILHFAAKSGNLNLVNWLI---KNKADIHAKTNSGETILHFAAKSGNLNLVNWLIKNKADIHAKTNSGETILHFAAESGNLNLVSLLIHNGTDINTKTDDGLTALHYAVESGNLNLVSLLIHKGIDVNA 1025          

HSP 5 Score: 87.8113 bits (216), Expect = 5.888e-17
Identity = 51/134 (38.06%), Postives = 74/134 (55.22%), Query Frame = 2
Query:  284 RNDDDRTLLHVAASCGHPEVVEILLSVDESANVVNAVDEEGWAPIHSAASIGNVTIVEMLLSKGADVNLKNDGGRTALHYAASKGWLKIVELLISRGAKINSKDKVGCTALHRGASTGNSALCELLIEEGAEVD 685
            + D+  T+LH A S  + ++V +L++       VNA  + G   +H A   GN+ +V +L+S GADVN K + G T L+ A   G   +V LLI+ GA +N+K   G T LH    +GN  L  LLI  GA V+
Sbjct:  700 KTDNGETVLHYAVSFNNSDLVYLLIAYGAD---VNAKTDNGLTALHYAVYDGNLDLVSLLISHGADVNAKTNSGETILYSAVDYGSPDLVYLLIAYGADVNAKTDNGETVLHYAVESGNLDLVSLLIHNGANVN 830          

HSP 6 Score: 87.4261 bits (215), Expect = 7.690e-17
Identity = 50/134 (37.31%), Postives = 72/134 (53.73%), Query Frame = 2
Query:  284 RNDDDRTLLHVAASCGHPEVVEILLSVDESANVVNAVDEEGWAPIHSAASIGNVTIVEMLLSKGADVNLKNDGGRTALHYAASKGWLKIVELLISRGAKINSKDKVGCTALHRGASTGNSALCELLIEEGAEVD 685
            + DD  T LH A   G+  +V +L+        VNA    G   +H A  +G++ +V +L+ +GADVN K D G TALHYA     L +V LL+  GA +N+K+  G T LH      +  L  LLI  GA+++
Sbjct:  993 KTDDGLTALHYAVESGNLNLVSLLI---HKGIDVNAKTNSGETILHFAVDLGSLDLVSLLMVRGADVNAKTDDGLTALHYAVESDNLALVSLLMVYGADVNAKNNSGETPLHYAVIFNSLDLVSLLIHNGADIN 1123          

HSP 7 Score: 83.5741 bits (205), Expect = 1.110e-15
Identity = 51/128 (39.84%), Postives = 67/128 (52.34%), Query Frame = 2
Query:  305 LLHVAASCGHPEVVEILLSVDESANVVNAVDEEGWAPIHSAASIGNVTIVEMLLSKGADVNLKNDGGRTALHYAASKGWLKIVELLISRGAKINSKDKVGCTALHRGASTGNSALCELLIEEGAEVDA 688
            LL +    G  E V +L++   + N  N     G   +H AA  GN+ + ++L   GADVN K D G T LHYA   G L +V+ LI   A I++K   G T LH   S  NS L  LLI  GA+V+A
Sbjct:  608 LLRLGLQLGCVESVPLLITHGANPNATNC---HGVISLHCAAKNGNLDLAKLLAKNGADVNAKTDNGETVLHYAVKSGNLHLVKWLIENQANIHAKTDNGETVLHYAVSFNNSDLVYLLIAYGADVNA 732          

HSP 8 Score: 82.8037 bits (203), Expect = 1.894e-15
Identity = 49/127 (38.58%), Postives = 71/127 (55.91%), Query Frame = 2
Query:  308 LHVAASCGHPEVVEILLSVDESANVVNAVDEEGWAPIHSAASIGNVTIVEMLLSKGADVNLKNDGGRTALHYAASKGWLKIVELLISRGAKINSKDKVGCTALHRGASTGNSALCELLIEEGAEVDA 688
            LH AA  G+ ++ ++L    ++   VNA  + G   +H A   GN+ +V+ L+   A+++ K D G T LHYA S     +V LLI+ GA +N+K   G TALH     GN  L  LLI  GA+V+A
Sbjct:  642 LHCAAKNGNLDLAKLLA---KNGADVNAKTDNGETVLHYAVKSGNLHLVKWLIENQANIHAKTDNGETVLHYAVSFNNSDLVYLLIAYGADVNAKTDNGLTALHYAVYDGNLDLVSLLISHGADVNA 765          

HSP 9 Score: 82.4185 bits (202), Expect = 2.474e-15
Identity = 51/135 (37.78%), Postives = 72/135 (53.33%), Query Frame = 2
Query:  284 RNDDDRTLLHVAASCGHPEVVEILLSVDESANVVNAVDEEGWAPIHSAASIGNVTIVEMLLSKGADVNLKNDGGRTALHYAASKGWLKIVELLISRGAKINSKDKVGCTALHRGASTGNSALCELLIEEGAEVDA 688
            + D+  T LH A   G+ ++V +L+S       VNA    G   ++SA   G+  +V +L++ GADVN K D G T LHYA   G L +V LLI  GA +N+      T LH  A +GN  L   LI+  A++ A
Sbjct:  733 KTDNGLTALHYAVYDGNLDLVSLLISHGAD---VNAKTNSGETILYSAVDYGSPDLVYLLIAYGADVNAKTDNGETVLHYAVESGNLDLVSLLIHNGANVNNAK----TILHFAAKSGNLNLVNWLIKNKADIHA 860          

HSP 10 Score: 80.1073 bits (196), Expect = 1.228e-14
Identity = 46/134 (34.33%), Postives = 71/134 (52.99%), Query Frame = 2
Query:  284 RNDDDRTLLHVAASCGHPEVVEILLSVDESANVVNAVDEEGWAPIHSAASIGNVTIVEMLLSKGADVNLKNDGGRTALHYAASKGWLKIVELLISRGAKINSKDKVGCTALHRGASTGNSALCELLIEEGAEVD 685
            + +   T+LH AA  G+  +V  L+   ++   ++A    G   +H AA  GN+ +V  L+   AD++ K + G T LH+AA  G L +V  LI   A I++K   G T LH  A +GN  L  LLI  G +++
Sbjct:  861 KTNSGETILHFAAESGNLNLVNWLI---KNKADIHAKTNSGETILHFAAKSGNLNLVNWLIKNKADIHAKTNSGETILHFAAKSGNLNLVNWLIKNKADIHAKTNSGETILHFAAESGNLNLVSLLIHNGTDIN 991          

HSP 11 Score: 78.1814 bits (191), Expect = 4.665e-14
Identity = 46/134 (34.33%), Postives = 70/134 (52.24%), Query Frame = 2
Query:  284 RNDDDRTLLHVAASCGHPEVVEILLSVDESANVVNAVDEEGWAPIHSAASIGNVTIVEMLLSKGADVNLKNDGGRTALHYAASKGWLKIVELLISRGAKINSKDKVGCTALHRGASTGNSALCELLIEEGAEVD 685
            + +   T+LH A   G  ++V +L+        VNA  ++G   +H A    N+ +V +L+  GADVN KN+ G T LHYA     L +V LLI  GA IN+K+  G T L+      N  + +  I  GA+++
Sbjct: 1026 KTNSGETILHFAVDLGSLDLVSLLMVRGAD---VNAKTDDGLTALHYAVESDNLALVSLLMVYGADVNAKNNSGETPLHYAVIFNSLDLVSLLIHNGADINTKNNSGETVLNSIMEFNNCNILKSFILGGADIN 1156          

HSP 12 Score: 77.411 bits (189), Expect = 7.958e-14
Identity = 46/130 (35.38%), Postives = 70/130 (53.85%), Query Frame = 2
Query:  299 RTLLHVAASCGHPEVVEILLSVDESANVVNAVDEEGWAPIHSAASIGNVTIVEMLLSKGADVNLKNDGGRTALHYAASKGWLKIVELLISRGAKINSKDKVGCTALHRGASTGNSALCELLIEEGAEVDA 688
            +T+LH AA  G+  +V  L+   ++   ++A    G   +H AA  GN+ +V  L+   AD++ K + G T LH+AA  G L +V  LI   A I++K   G T LH  A +GN  L   LI+  A++ A
Sbjct:  833 KTILHFAAKSGNLNLVNWLI---KNKADIHAKTNSGETILHFAAESGNLNLVNWLIKNKADIHAKTNSGETILHFAAKSGNLNLVNWLIKNKADIHAKTNSGETILHFAAKSGNLNLVNWLIKNKADIHA 959          

HSP 13 Score: 75.0998 bits (183), Expect = 3.950e-13
Identity = 46/135 (34.07%), Postives = 71/135 (52.59%), Query Frame = 2
Query:  284 RNDDDRTLLHVAASCGHPEVVEILLSVDESANVVNAVDEEGWAPIHSAASIGNVTIVEMLLSKGADVNLKNDGGRTALHYAASKGWLKIVELLISRGAKINSKDKVGCTALHRGASTGNSALCELLIEEGAEVDA 688
            + +   T+L+ A   G P++V +L++       VNA  + G   +H A   GN+ +V +L+  GA+VN      +T LH+AA  G L +V  LI   A I++K   G T LH  A +GN  L   LI+  A++ A
Sbjct:  766 KTNSGETILYSAVDYGSPDLVYLLIAYGAD---VNAKTDNGETVLHYAVESGNLDLVSLLIHNGANVN----NAKTILHFAAKSGNLNLVNWLIKNKADIHAKTNSGETILHFAAESGNLNLVNWLIKNKADIHA 893          
BLAST of FC920380 vs. ExPASy Swiss-Prot
Match: Y045_METMA (Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei GN=MM_0045 PE=4 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 8.216e-19
Identity = 52/134 (38.81%), Postives = 79/134 (58.96%), Query Frame = 2
Query:  284 RNDDDRTLLHVAASCGHPEVVEILLSVDESANVVNAVDEEGWAPIHSAASIGNVTIVEMLLSKGADVNLKNDGGRTALHYAASKGWLKIVELLISRGAKINSKDKVGCTALHRGASTGNSALCELLIEEGAEVD 685
            ++++  T L  AA   H ++ E+L+      N+    D  G   + +A  IG+  IVE+L++ GAD+NL++  G TAL YAA +G+  IV LLI  GA +N  D+ G TAL   A TG   + ELLI+ GA+++
Sbjct:  196 QDENGETALICAADRAHRDIAELLIKAGADLNIQ---DNSGKTALVAATKIGHKGIVELLVNAGADLNLQDKNGNTALIYAADRGYRDIVNLLIEGGASLNIPDEAGLTALMFSAQTGRKDIVELLIKAGADIN 326          

HSP 2 Score: 75.0998 bits (183), Expect = 3.950e-13
Identity = 45/129 (34.88%), Postives = 74/129 (57.36%), Query Frame = 2
Query:  299 RTLLHVAASCGHPEVVEILLSVDESANVVNAVDEEGWAPIHSAASIGNVTIVEMLLSKGADVNLKNDGGRTALHYAASKGWLKIVELLISRGAKINSKDKVGCTALHRGASTGNSALCELLIEEGAEVD 685
            +T L  AA  G+ +V+ +L+   ES   ++  DE G   + SAA I    I+++L+  GAD+N +++ G TAL +A   G+  I + LI  G  +N +D+ G TAL   A   +  + ELLI+ GA+++
Sbjct:  102 KTALISAADKGYRDVIGLLI---ESGPNLDLQDENGNTALISAAKIERGDIIDLLVKNGADLNFQDENGETALKFAVKVGYKNIADQLIDAGTDLNIQDENGETALICAADRAHRDIAELLIKAGADLN 227          

HSP 3 Score: 75.0998 bits (183), Expect = 3.950e-13
Identity = 46/134 (34.33%), Postives = 72/134 (53.73%), Query Frame = 2
Query:  284 RNDDDRTLLHVAASCGHPEVVEILLSVDESANVVNAVDEEGWAPIHSAASIGNVTIVEMLLSKGADVNLKNDGGRTALHYAASKGWLKIVELLISRGAKINSKDKVGCTALHRGASTGNSALCELLIEEGAEVD 685
            ++++  T L  A   G+  + + L+      N+    DE G   +  AA   +  I E+L+  GAD+N++++ G+TAL  A   G   IVELL++ GA +N +DK G TAL   A  G   +  LLIE GA ++
Sbjct:  163 QDENGETALKFAVKVGYKNIADQLIDAGTDLNIQ---DENGETALICAADRAHRDIAELLIKAGADLNIQDNSGKTALVAATKIGHKGIVELLVNAGADLNLQDKNGNTALIYAADRGYRDIVNLLIEGGASLN 293          

HSP 4 Score: 72.7886 bits (177), Expect = 1.960e-12
Identity = 41/134 (30.60%), Postives = 72/134 (53.73%), Query Frame = 2
Query:  284 RNDDDRTLLHVAASCGHPEVVEILLSVDESANVVNAVDEEGWAPIHSAASIGNVTIVEMLLSKGADVNLKNDGGRTALHYAASKGWLKIVELLISRGAKINSKDKVGCTALHRGASTGNSALCELLIEEGAEVD 685
            ++++  T L  AA     +++++L+   ++   +N  DE G   +  A  +G   I + L+  G D+N++++ G TAL  AA +    I ELLI  GA +N +D  G TAL      G+  + ELL+  GA+++
Sbjct:  130 QDENGNTALISAAKIERGDIIDLLV---KNGADLNFQDENGETALKFAVKVGYKNIADQLIDAGTDLNIQDENGETALICAADRAHRDIAELLIKAGADLNIQDNSGKTALVAATKIGHKGIVELLVNAGADLN 260          

HSP 5 Score: 68.9366 bits (167), Expect = 2.830e-11
Identity = 44/126 (34.92%), Postives = 66/126 (52.38%), Query Frame = 2
Query:  284 RNDDDRTLLHVAASCGHPEVVEILLSVDESANVVNAVDEEGWAPIHSAASIGNVTIVEMLLSKGADVNLKNDGGRTALHYAASKGWLKIVELLISRGAKINSKDKVGCTALHRGASTGNSALCELL 661
            +++  +T L  A   GH  +VE+L++     N+    D+ G   +  AA  G   IV +L+  GA +N+ ++ G TAL ++A  G   IVELLI  GA IN +DK   TA    A  G   + +LL
Sbjct:  229 QDNSGKTALVAATKIGHKGIVELLVNAGADLNLQ---DKNGNTALIYAADRGYRDIVNLLIEGGASLNIPDEAGLTALMFSAQTGRKDIVELLIKAGADINIEDKNNKTAADLAAEVGFEEIVDLL 351          
BLAST of FC920380 vs. ExPASy Swiss-Prot
Match: ANR52_DANRE (Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 1.073e-18
Identity = 53/131 (40.46%), Postives = 78/131 (59.54%), Query Frame = 2
Query:  296 DRTLLHVAASCGHPEVVEILLSVDESANVVNAVDEEGWAPIHSAASIGNVTIVEMLLSKGADVNLKNDGGRTALHYAASKGWLKIVELLISRGAKINSKDKVGCTALHRGASTGNSALC-ELLIEEGAEVD 685
            DR  +H AA  GH EVV++L+S     +     D+ G+ P+H+AA+ G+V +V+ LL  GA+++  N  G TALH A   G   +   L++RGA +N  +  G T LH  A + N ALC ELL+  GA+V+
Sbjct:  173 DRQPIHWAAYLGHLEVVKLLVSQGSDKS---CKDKRGYTPLHAAAASGHVDVVKYLLRNGAEIDEPNAFGNTALHVACYTGQEAVANELVNRGANVNQPNHRGYTPLHLAAVSTNGALCLELLVNNGADVN 300          

HSP 2 Score: 87.8113 bits (216), Expect = 5.888e-17
Identity = 50/129 (38.76%), Postives = 82/129 (63.57%), Query Frame = 2
Query:  299 RTLLHVAASCGHPEVVEILLSVDESANVVNAVDEEGWAPIHSAASIGNVTIVEMLLSKGADVNLKNDGGRTALHYAASKGWLKIVELLISRGAKINSKDKVGCTALHRGASTGNSALCELLIEEGAEVD 685
            R  LH AA  G+ E+V++LL+  + AN+ +A D++   PIH AA +G++ +V++L+S+G+D + K+  G T LH AA+ G + +V+ L+  GA+I+  +  G TALH    TG  A+   L+  GA V+
Sbjct:  141 RAPLHHAAQSGYQEMVKLLLN--KGANL-SASDKKDRQPIHWAAYLGHLEVVKLLVSQGSDKSCKDKRGYTPLHAAAASGHVDVVKYLLRNGAEIDEPNAFGNTALHVACYTGQEAVANELVNRGANVN 266          

HSP 3 Score: 87.4261 bits (215), Expect = 7.690e-17
Identity = 50/129 (38.76%), Postives = 79/129 (61.24%), Query Frame = 2
Query:  299 RTLLHVAASCGHPEVVEILLSVDESANVVNAVDEEGWAPIHSAASIGNVTIVEMLLSKGADVNLKNDGGRTALHYAASKGWLKIVELLISRGAKINSKDKVGCTALHRGASTGNSALCELLIEEGAEVD 685
            +T LH+AA+      VE LL    S N+    D  G AP+H AA  G   +V++LL+KGA+++  +   R  +H+AA  G L++V+LL+S+G+  + KDK G T LH  A++G+  + + L+  GAE+D
Sbjct:  108 QTPLHIAAANRATRCVETLLPHVSSLNMA---DRTGRAPLHHAAQSGYQEMVKLLLNKGANLSASDKKDRQPIHWAAYLGHLEVVKLLVSQGSDKSCKDKRGYTPLHAAAASGHVDVVKYLLRNGAEID 233          

HSP 4 Score: 80.8777 bits (198), Expect = 7.198e-15
Identity = 40/90 (44.44%), Postives = 59/90 (65.56%), Query Frame = 2
Query:  383 VNAVDEEGWAPIHSAASIGNVTIVEMLLSKGADVNLKNDGGRTALHYAASKGWLKIVELLISRGAKINSKDKVGCTALHRGASTGNSALC 652
            +N  D  G   +H+AAS GN+  + +LLS GAD+N K+  GRT LHYAA+ G  + V +L+  GA++N +D+ GCT LH  A+  ++A C
Sbjct:  416 INTPDNFGRTCLHAAASGGNIECLNLLLSSGADMNKKDKFGRTPLHYAAANGRYQCVVVLVGAGAEVNERDRSGCTPLHYSAA--STAFC 503          

HSP 5 Score: 78.9518 bits (193), Expect = 2.735e-14
Identity = 46/135 (34.07%), Postives = 73/135 (54.07%), Query Frame = 2
Query:  287 NDDDRTLLHVAASCGHPEVVEILLSVDESANVVNAVDEEGWAPIHSAASIGNVTIVEMLLSKGADVNLKNDGGRTALHYAASKGWLKIVELLISRGAKINSKDKVGCTALHRGASTGNSALCELLIEEGAEVDAT 691
            + + RT LH AA  G   ++++L+S   +   VNA D     P+H AA+  N   V +LL KGADV  ++   +T LH AA+    + VE L+   + +N  D+ G   LH  A +G   + +LL+ +GA + A+
Sbjct:   38 DQERRTPLHAAAWLGDVHIMDLLISAGAN---VNAKDHVWLTPLHRAAASRNERAVGLLLRKGADVTARDKYWQTPLHIAAANRATRCVETLLPHVSSLNMADRTGRAPLHHAAQSGYQEMVKLLLNKGANLSAS 169          

HSP 6 Score: 77.7962 bits (190), Expect = 6.093e-14
Identity = 45/119 (37.82%), Postives = 67/119 (56.30%), Query Frame = 2
Query:  308 LHVAASCGHPEVVEILLSVDESANVVNAVDEEGWAPIHSAASIGNVTIVEMLLSKGADVNLKNDGGRTALHYAASKGWLKIVELLISRGAKINSKDKVGCTALHRGASTGNSALCELLI 664
            LHVAA+ GH E + +LL  +  A++VN  D EG  P+  A   G+   V +LL +GA  ++K+  GRTALH  A  G    +  L+S    + S+D  G +ALH  AS G++ +   L+
Sbjct:  650 LHVAAANGHSECLRMLLCSEGGADLVNVTDAEGQTPLMLAVLGGHTDCVHLLLERGACPDMKDRRGRTALHRGAVMGREDCLTALLSHNVSVLSRDFQGRSALHLAASCGHADILSNLL 768          

HSP 7 Score: 75.0998 bits (183), Expect = 3.950e-13
Identity = 51/131 (38.93%), Postives = 71/131 (54.20%), Query Frame = 2
Query:  299 RTLLHVAASCGHPEVVEILLSVDESANVVNAVDEEGWAPIHSAASIGNVTIVEMLLSK--GAD-VNLKNDGGRTALHYAASKGWLKIVELLISRGAKINSKDKVGCTALHRGASTGNSALCELLIEEGAEV 682
            R++L++A+  GH   VE+LLS  +SA+ + A     W P+H AA+ G+   + MLL    GAD VN+ +  G+T L  A   G    V LL+ RGA  + KD+ G TALHRGA  G       L+     V
Sbjct:  613 RSVLYLASQRGHSRCVELLLS--QSASCLLAEHRSKWGPLHVAAANGHSECLRMLLCSEGGADLVNVTDAEGQTPLMLAVLGGHTDCVHLLLERGACPDMKDRRGRTALHRGAVMGREDCLTALLSHNVSV 741          

HSP 8 Score: 73.9442 bits (180), Expect = 8.799e-13
Identity = 47/127 (37.01%), Postives = 68/127 (53.54%), Query Frame = 2
Query:  302 TLLHVAASCGHPEVVEILLSVDESANVVNAVDEEGWAPIHSAA-SIGNVTIVEMLLSKGADVNLKNDGGRTALHYAASKGWLKIVELLISRGAKINSKDKVGCTALHRGASTGNSALCELLIEEGAE 679
            T LHVA   G   V   L  V+  ANV N  +  G+ P+H AA S      +E+L++ GADVN+++  G++ LH AA  G     ++LI  G +I+  D+ G T LH  A  G+  L   L+  GA+
Sbjct:  241 TALHVACYTGQEAVANEL--VNRGANV-NQPNHRGYTPLHLAAVSTNGALCLELLVNNGADVNMQSKEGKSPLHMAAIHGRFTRSQILIQNGGEIDCVDRYGNTPLHVAAKYGHELLISTLMTNGAD 364          

HSP 9 Score: 71.2478 bits (173), Expect = 5.703e-12
Identity = 52/148 (35.14%), Postives = 75/148 (50.68%), Query Frame = 2
Query:  302 TLLHVAASCGHPEVVEILLS--VDESANVVNAVDEEGWAPIHSAASIGN-------------VTIV-----EMLLSKGADVNLKNDGGRTALHYAASKGWLKIVELLISRGAKINSKDKVGCTALHRGASTGNSALCELLIEEGAEVD 685
            T LHVAA  GH  ++  L++   D +   ++     G  P+H A   G+              +IV     E +LS G D+N  ++ GRT LH AAS G ++ + LL+S GA +N KDK G T LH  A+ G      +L+  GAEV+
Sbjct:  341 TPLHVAAKYGHELLISTLMTNGADTARQGIH-----GMFPLHLAVLYGSSDCCRKLLSSGQLYSIVLSMSKEHVLSAGFDINTPDNFGRTCLHAAASGGNIECLNLLLSSGADMNKKDKFGRTPLHYAAANGRYQCVVVLVGAGAEVN 483          

HSP 10 Score: 67.3958 bits (163), Expect = 8.235e-11
Identity = 37/94 (39.36%), Postives = 59/94 (62.77%), Query Frame = 2
Query:  383 VNAVDEEGWAPIHSAASIGNVTIVEMLLSKGADVNLKNDGGRTALHYAASKGWLKIVELLISRGAKINSKDKVGCTALHRGASTGNSALCELLI 664
            VNA+D+E   P+H+AA +G+V I+++L+S GA+VN K+    T LH AA+    + V LL+ +GA + ++DK   T LH  A+   +   E L+
Sbjct:   34 VNALDQERRTPLHAAAWLGDVHIMDLLISAGANVNAKDHVWLTPLHRAAASRNERAVGLLLRKGADVTARDKYWQTPLHIAAANRATRCVETLL 127          
BLAST of FC920380 vs. ExPASy Swiss-Prot
Match: ANR28_MOUSE (Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 3.122e-18
Identity = 54/131 (41.22%), Postives = 78/131 (59.54%), Query Frame = 2
Query:  296 DRTLLHVAASCGHPEVVEILLSVDESANVVNAVDEEGWAPIHSAASIGNVTIVEMLLSKGADVNLKNDGGRTALHYAASKGWLKIVELLISRGAKINSKDKVGCTALHRGASTGNSALC-ELLIEEGAEVD 685
            DR  +H AA  GH EVV++L+S       V   D++ + P+H+AAS G +++V+ LL  G D+N  N  G T LH A   G   +V  LI  GA +N K++ G T LH  A++ + ALC ELL+  GA+V+
Sbjct:  173 DRRAIHWAAYMGHIEVVKLLVSHGAE---VTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGANVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVN 300          

HSP 2 Score: 85.5001 bits (210), Expect = 2.922e-16
Identity = 51/129 (39.53%), Postives = 75/129 (58.14%), Query Frame = 2
Query:  299 RTLLHVAASCGHPEVVEILLSVDESANVVNAVDEEGWAPIHSAASIGNVTIVEMLLSKGADVNLKNDGGRTALHYAASKGWLKIVELLISRGAKINSKDKVGCTALHRGASTGNSALCELLIEEGAEVD 685
            RT LH AA  GH E+V++LLS    AN+ NA D++    IH AA +G++ +V++L+S GA+V  K+    T LH AAS G + +V+ L+  G  +N  +  G T LH     G   +   LI+ GA V+
Sbjct:  141 RTALHHAAFSGHGEMVKLLLS--RGANI-NAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGANVN 266          

HSP 3 Score: 84.3445 bits (207), Expect = 6.510e-16
Identity = 47/135 (34.81%), Postives = 77/135 (57.04%), Query Frame = 2
Query:  284 RNDDDRTLLHVAASCGHPEVVEILLSVDESANVVNAVDEEGWAPIHSAASIGNVTIVEMLLSKGADVNLKNDGGRTALHYAASKGWLKIVELLISRGAKINSKDKVGCTALHRGASTGNSALCELLIEEGAEVDA 688
            ++++ RT LH AA  G  E++E+L+    S   VNA D +   P+H A +  +   V++LL   ADVN ++   +T LH AA+   +K  E L+   + +N  D+ G TALH  A +G+  + +LL+  GA ++A
Sbjct:   37 QDNEKRTPLHAAAYLGDAEIIELLIL---SGARVNAKDSKWLTPLHRAVASCSEEAVQILLKHSADVNARDKNWQTPLHIAAANKAVKCAESLVPLLSNVNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINA 168          

HSP 4 Score: 82.4185 bits (202), Expect = 2.474e-15
Identity = 47/130 (36.15%), Postives = 70/130 (53.85%), Query Frame = 2
Query:  299 RTLLHVAASCGHPEVVEILLSVDESANVVNAVDEEGWAPIHSAASIGNVTIVEMLLSKGADVNLKNDGGRTALHYAASKGWLKIVELLISRGAKINSKDKVGCTALHRGASTGNSALCELLIEEGAEVDA 688
            RT +H AA+ GH E + +L+   E  N V+  D  G  P+  +   G+   V  LL+KGA+V+ K+  GRTALH  A  G  + V+ L+  GAK   +D  G T +H  A+ G+  +   L++    VDA
Sbjct:  618 RTPIHAAATNGHSECLRLLIGNAEPQNAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVDALLQHGAKCLLRDSRGRTPIHLSAACGHIGVLGALLQSATSVDA 747          

HSP 5 Score: 81.2629 bits (199), Expect = 5.511e-15
Identity = 54/127 (42.52%), Postives = 76/127 (59.84%), Query Frame = 2
Query:  302 TLLHVAASCGHPEVVEILLSVDESANVVNAVDEEGWAPIHSAASIGNVTIVEMLLSKGADVNLKNDGGRTALHYAASKGWLKIVELLISRGAKINSKDKVGCTALHRGASTGNSALCELLIEEGAEV 682
            T LH A +    E V+ILL    SA+V NA D+    P+H AA+   V   E L+   ++VN+ +  GRTALH+AA  G  ++V+LL+SRGA IN+ DK    A+H  A  G+  + +LL+  GAEV
Sbjct:   76 TPLHRAVASCSEEAVQILLK--HSADV-NARDKNWQTPLHIAAANKAVKCAESLVPLLSNVNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEV 199          

HSP 6 Score: 81.2629 bits (199), Expect = 5.511e-15
Identity = 46/134 (34.33%), Postives = 82/134 (61.19%), Query Frame = 2
Query:  284 RNDDDRTLLHVAASCGHPEVVEILLSVDESANVVNAVDEEGWAPIHSAASIGNVTIVEMLLSKGADVNLKNDGGRTALHYAASKGWLKIVELLISRGAKINSKDKVGCTALHRGASTGNSALCELLIEEGAEVD 685
            R+ + +T LH+AA+    +  E L+ +  + NV    D  G   +H AA  G+  +V++LLS+GA++N  +   R A+H+AA  G +++V+LL+S GA++  KDK   T LH  AS+G  ++ + L++ G +++
Sbjct:  103 RDKNWQTPLHIAAANKAVKCAESLVPLLSNVNVS---DRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMN 233          

HSP 7 Score: 78.1814 bits (191), Expect = 4.665e-14
Identity = 52/129 (40.31%), Postives = 68/129 (52.71%), Query Frame = 2
Query:  302 TLLHVAASCGHPEVVEILLSVDESANVVNAVDEEGWAPIHSAASIGNVTIVEMLLSKGADVNLKNDGGRTALHYAA-SKGWLKIVELLISRGAKINSKDKVGCTALHRGASTGNSALCELLIEEGAEVD 685
            T LH AAS G   VV+ LL +    N  NA    G  P+H A   G   +V  L+  GA+VN KN+ G T LH+AA S      +ELL+  GA +N K K G T LH  A  G  +  + +I+ GA +D
Sbjct:  208 TPLHAAASSGMISVVKYLLDLGVDMNEPNAY---GNTPLHVACYNGQDVVVNELIDCGANVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVID 333          

HSP 8 Score: 78.1814 bits (191), Expect = 4.665e-14
Identity = 52/127 (40.94%), Postives = 70/127 (55.12%), Query Frame = 2
Query:  302 TLLHVAASCGHPEVVEILLSVDESANVVNAVDEEGWAPIH-SAASIGNVTIVEMLLSKGADVNLKNDGGRTALHYAASKGWLKIVELLISRGAKINSKDKVGCTALHRGASTGNSALCELLIEEGAE 679
            T LHVA   G   VV  L  +D  ANV N  +E+G+ P+H +AAS      +E+L+  GADVN+K+  G+T LH  A  G     + +I  GA I+ +DK G T LH  A  G+  L   LI  GA+
Sbjct:  241 TPLHVACYNGQDVVVNEL--IDCGANV-NQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTLITSGAD 364          

HSP 9 Score: 73.1738 bits (178), Expect = 1.501e-12
Identity = 47/130 (36.15%), Postives = 68/130 (52.31%), Query Frame = 2
Query:  302 TLLHVAASCGHPEVVEILLS--VDESANVVNAVDEEGWAPIHSAASIGNVTIVEMLLSKGADVNLKNDGGRTALHYAASKGWLKIVELLISRGAKINSKDKVGCTALHRGASTGNSALCELLIEEGAEVD 685
            T LH+AA  GH  ++  L++   D +   ++     G  P+H AA  G       LLS G D++  +D GRT LH AA+ G L+ + LL++ GA  N KDK G + LH  A+  N      L+  GA V+
Sbjct:  341 TPLHIAARYGHELLINTLITSGADTAKRGIH-----GMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNKKDKFGRSPLHYAAANCNYQCLFALVGSGASVN 465          

HSP 10 Score: 73.1738 bits (178), Expect = 1.501e-12
Identity = 45/124 (36.29%), Postives = 68/124 (54.84%), Query Frame = 2
Query:  308 LHVAASCGHPEVVEILLSVDESANVVNAVDEEGWAPIHSAASIGNVTIVEMLLSKGADVNLKNDGGRTALHYAASKGWLKIVELLISRGAKINSKDKVGCTALHRGASTGNSALC-ELLIEEGA 676
            LH+AA  G  +    LLS   S   ++  D+ G   +H+AA+ GN+  + +LL+ GAD N K+  GR+ LHYAA+    + +  L+  GA +N  D+ GCT LH  A++     C E L+   A
Sbjct:  376 LHLAALSGFSDCCRKLLS---SGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNKKDKFGRSPLHYAAANCNYQCLFALVGSGASVNDLDERGCTPLHYAATSDTDGKCLEYLLRNDA 496          

HSP 11 Score: 69.3218 bits (168), Expect = 2.167e-11
Identity = 49/132 (37.12%), Postives = 67/132 (50.76%), Query Frame = 2
Query:  302 TLLHVAASCGHPEVVEILLSVDESANVVNAVDEEGWAPIHSAASIGNVTIVEMLL-SKGAD-VNLKNDGGRTALHYAASKGWLKIVELLISRGAKINSKDKVGCTALHRGASTGNSALCELLIEEGAEVDAT 691
            T LH A   GH   VE+LL  D    V   +D   ++P+H A    N    EML+ S GA  VN  +  GRT LH AA    ++ ++LL+S+ A++NS D  G T L   A  G +   E+L+   A  D T
Sbjct:  758 TALHWACYNGHETCVELLLEQD----VFQKIDGNAFSPLHCAVINDNEGAAEMLIDSLGASIVNATDSKGRTPLHAAAFTDHVECLQLLLSQNAQVNSADSTGKTPLMMAAENGQTNTVEMLV-SSASADLT 884          

HSP 12 Score: 68.1662 bits (165), Expect = 4.828e-11
Identity = 41/132 (31.06%), Postives = 66/132 (50.00%), Query Frame = 2
Query:  284 RNDDDRTLLHVAASCGHPEVVEILLSVDESANVVNAVDEEGWAPIHSAASIGNVTIVEMLLSKGADVNLKNDGGRTALHYAASKGWLKIVELLISRGAKINSKDKVGCTALHRGASTGNSALCELLIEEGAE 679
            ++ D +T LH+ A  G     + ++   +S  V++  D+ G  P+H AA  G+  ++  L++ GAD   +   G   LH AA  G+      L+S G  I++ D  G T LH  A+ GN     LL+  GA+
Sbjct:  302 KSKDGKTPLHMTALHGRFSRSQTII---QSGAVIDCEDKNGNTPLHIAARYGHELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGAD 430          

HSP 13 Score: 67.3958 bits (163), Expect = 8.235e-11
Identity = 42/122 (34.43%), Postives = 65/122 (53.28%), Query Frame = 2
Query:  308 LHVAASCGHPEVVEILLSVDESANVVNAVDEEGWAPIHSAASIGNVTIVEMLLSKGADVNLKNDGGRTALHYAASKGWLKIVELLI-SRGAKINSKDKVGCTALHRGASTGNSALCELLIEE 670
            LH A    +    E+L+     A++VNA D +G  P+H+AA   +V  +++LLS+ A VN  +  G+T L  AA  G    VE+L+ S  A +  +DK   TALH     G+     L++E+
Sbjct:  792 LHCAVINDNEGAAEMLID-SLGASIVNATDSKGRTPLHAAAFTDHVECLQLLLSQNAQVNSADSTGKTPLMMAAENGQTNTVEMLVSSASADLTLQDKSKNTALHLACGKGHETSALLILEK 912          
BLAST of FC920380 vs. ExPASy Swiss-Prot
Match: ANR44_CHICK (Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 4.078e-18
Identity = 54/131 (41.22%), Postives = 77/131 (58.78%), Query Frame = 2
Query:  296 DRTLLHVAASCGHPEVVEILLSVDESANVVNAVDEEGWAPIHSAASIGNVTIVEMLLSKGADVNLKNDGGRTALHYAASKGWLKIVELLISRGAKINSKDKVGCTALHRGASTGNSALC-ELLIEEGAEVD 685
            DR  LH AA  GH EVV +L++       V   D++G+ P+H+AAS G + IV+ LL+ G +++  N  G TALH A   G   +V  LI  GA +N  +  G T LH  A++ + ALC ELL+  GA+V+
Sbjct:  173 DRRALHWAAYMGHLEVVALLINHGAE---VTCKDKKGYTPLHAAASNGQINIVKHLLNLGVEIDEMNIYGNTALHIACYNGQDSVVNELIDYGANVNQPNNNGFTPLHFAAASTHGALCLELLVNNGADVN 300          

HSP 2 Score: 90.1225 bits (222), Expect = 1.186e-17
Identity = 54/134 (40.30%), Postives = 80/134 (59.70%), Query Frame = 2
Query:  284 RNDDDRTLLHVAASCGHPEVVEILLSVDESANVVNAVDEEGWAPIHSAASIGNVTIVEMLLSKGADVNLKNDGGRTALHYAASKGWLKIVELLISRGAKINSKDKVGCTALHRGASTGNSALCELLIEEGAEVD 685
            R+ + +T LHVAA+    +  EI++ +  S NV    D  G   +H AA  G+V +V +LL+KGA++N  +   R ALH+AA  G L++V LLI+ GA++  KDK G T LH  AS G   + + L+  G E+D
Sbjct:  103 RDKNWQTPLHVAAANKALKCAEIIIPMLSSVNVS---DRGGRTALHHAALNGHVEMVNLLLAKGANINAFDKKDRRALHWAAYMGHLEVVALLINHGAEVTCKDKKGYTPLHAAASNGQINIVKHLLNLGVEID 233          

HSP 3 Score: 84.7297 bits (208), Expect = 4.985e-16
Identity = 51/129 (39.53%), Postives = 79/129 (61.24%), Query Frame = 2
Query:  299 RTLLHVAASCGHPEVVEILLSVDESANVVNAVDEEGWAPIHSAASIGNVTIVEMLLSKGADVNLKNDGGRTALHYAASKGWLKIVELLISRGAKINSKDKVGCTALHRGASTGNSALCELLIEEGAEVD 685
            RT LH AA  GH E+V +LL+  + AN+ NA D++    +H AA +G++ +V +L++ GA+V  K+  G T LH AAS G + IV+ L++ G +I+  +  G TALH     G  ++   LI+ GA V+
Sbjct:  141 RTALHHAALNGHVEMVNLLLA--KGANI-NAFDKKDRRALHWAAYMGHLEVVALLINHGAEVTCKDKKGYTPLHAAASNGQINIVKHLLNLGVEIDEMNIYGNTALHIACYNGQDSVVNELIDYGANVN 266          

HSP 4 Score: 81.6481 bits (200), Expect = 4.220e-15
Identity = 51/127 (40.16%), Postives = 76/127 (59.84%), Query Frame = 2
Query:  302 TLLHVAASCGHPEVVEILLSVDESANVVNAVDEEGWAPIHSAASIGNVTIVEMLLSKGADVNLKNDGGRTALHYAASKGWLKIVELLISRGAKINSKDKVGCTALHRGASTGNSALCELLIEEGAEV 682
            T LH A +    E V++L+    SA+V NA D+    P+H AA+   +   E+++   + VN+ + GGRTALH+AA  G +++V LL+++GA IN+ DK    ALH  A  G+  +  LLI  GAEV
Sbjct:   76 TPLHRAVASRSEEAVQVLIK--HSADV-NARDKNWQTPLHVAAANKALKCAEIIIPMLSSVNVSDRGGRTALHHAALNGHVEMVNLLLAKGANINAFDKKDRRALHWAAYMGHLEVVALLINHGAEV 199          

HSP 5 Score: 80.8777 bits (198), Expect = 7.198e-15
Identity = 46/132 (34.85%), Postives = 74/132 (56.06%), Query Frame = 2
Query:  293 DDRTLLHVAASCGHPEVVEILLSVDESANVVNAVDEEGWAPIHSAASIGNVTIVEMLLSKGADVNLKNDGGRTALHYAASKGWLKIVELLISRGAKINSKDKVGCTALHRGASTGNSALCELLIEEGAEVDA 688
            + RT LHVA+  G  +++E+L+    S   VNA D     P+H A +  +   V++L+   ADVN ++   +T LH AA+   LK  E++I   + +N  D+ G TALH  A  G+  +  LL+ +GA ++A
Sbjct:   40 EKRTPLHVASFLGDADIIELLIL---SGARVNAKDNMWLTPLHRAVASRSEEAVQVLIKHSADVNARDKNWQTPLHVAAANKALKCAEIIIPMLSSVNVSDRGGRTALHHAALNGHVEMVNLLLAKGANINA 168          

HSP 6 Score: 76.2554 bits (186), Expect = 1.773e-13
Identity = 42/133 (31.58%), Postives = 74/133 (55.64%), Query Frame = 2
Query:  284 RNDDDRTLLHVAASCGHPEVVEILLSVDESANVVNAVDEEGWAPIHSAASIGNVTIVEMLLSKGADVNLKNDGGRTALHYAASKGWLKIVELLISRGAKINSKDKVGCTALHRGASTGNSALCELLIEEGAEV 682
            +++  RT L +AA  GH E VE L+S   S  V + V +    P+H++   G+   + +LL    + ++ +  G+T L  A + G +  V LL+ + A +++ D +GCTALHRG  TG+    ++L+E+   +
Sbjct:  596 KDEKGRTALDLAAFKGHAECVEALISQGASVTVKDNVTKR--TPLHASVINGHTPCLRLLLEVADNPDVTDAKGQTPLMLAVAYGHIDAVSLLLEKEASVDAADLLGCTALHRGIMTGHEECVQMLLEKEVSI 726          

HSP 7 Score: 75.0998 bits (183), Expect = 3.950e-13
Identity = 48/130 (36.92%), Postives = 74/130 (56.92%), Query Frame = 2
Query:  308 LHVAASCGHPEVVEILLSVDESANVVNAVDEEGW-APIHSAASIGNVTIVEMLLSKGADVNLKNDGGRTALHYAASKGWLKIVELLISRGAKINSKDKV-GCTALHRGASTGNSALCELLIEEGAEVDAT 691
            +H AA+ GH + +E+LL  ++++N+    D     +P+H AA  G+   +E+LL    D+++K++ GRTAL  AA KG  + VE LIS+GA +  KD V   T LH     G++    LL+E     D T
Sbjct:  536 VHYAAAYGHRQCLELLL--EKNSNMFEESDSSATKSPLHLAAYNGHHQALEVLLQSLVDLDIKDEKGRTALDLAAFKGHAECVEALISQGASVTVKDNVTKRTPLHASVINGHTPCLRLLLEVADNPDVT 663          

HSP 8 Score: 74.3294 bits (181), Expect = 6.737e-13
Identity = 48/127 (37.80%), Postives = 68/127 (53.54%), Query Frame = 2
Query:  302 TLLHVAASCGHPEVVEILLSVDESANVVNAVDEEGWAPIH-SAASIGNVTIVEMLLSKGADVNLKNDGGRTALHYAASKGWLKIVELLISRGAKINSKDKVGCTALHRGASTGNSALCELLIEEGAE 679
            T LH+A   G   VV  L  +D  ANV N  +  G+ P+H +AAS      +E+L++ GADVN+++  G++ LH  A  G     + LI  G +I+  DK G T LH  A  G+  L   LI  GA+
Sbjct:  241 TALHIACYNGQDSVVNEL--IDYGANV-NQPNNNGFTPLHFAAASTHGALCLELLVNNGADVNIQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDCVDKDGNTPLHVAARYGHELLINTLITSGAD 364          

HSP 9 Score: 73.9442 bits (180), Expect = 8.799e-13
Identity = 44/109 (40.37%), Postives = 61/109 (55.96%), Query Frame = 2
Query:  308 LHVAASCGHPEVVEILLSVDESANVVNAVDEEGWAPIHSAASIGNVTIVEMLLSKGADVNLKNDGGRTALHYAASKGWLKIVELLISRGAKINSKDKVGCTALHRGAST 634
            LH+AA   H +    LLS   S   ++  D  G   +H+AA+ GNV  +++L S GAD N K+  GRT LHYAA+      +E L++ GA IN  D  G T LH  A++
Sbjct:  376 LHLAALNAHSDCCRKLLS---SGFEIDTPDSFGRTCLHAAAAGGNVECIKLLQSSGADFNKKDKRGRTPLHYAAANCHFHCIETLVTTGANINETDDWGRTPLHYAAAS 481          

HSP 10 Score: 70.0922 bits (170), Expect = 1.271e-11
Identity = 46/133 (34.59%), Postives = 66/133 (49.62%), Query Frame = 2
Query:  293 DDRTLLHVAASCGHPEVVEILLSVDESANVVNAVDEEGWAPIHSAASIGNVTIVEMLLSKGADVNLKNDGGRTALHYAASKGWLKIVELLISRGAKINSKDKVGCTALHRGASTGNSALCELLIEEGAEVDAT 691
            D  T LHVAA  GH  ++  L++   S             P+H AA   +      LLS G +++  +  GRT LH AA+ G ++ ++LL S GA  N KDK G T LH  A+  +    E L+  GA ++ T
Sbjct:  338 DGNTPLHVAARYGHELLINTLIT---SGADTAKCGIHNMFPLHLAALNAHSDCCRKLLSSGFEIDTPDSFGRTCLHAAAAGGNVECIKLLQSSGADFNKKDKRGRTPLHYAAANCHFHCIETLVTTGANINET 467          
BLAST of FC920380 vs. ExPASy Swiss-Prot
Match: ANR28_HUMAN (Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=4)

HSP 1 Score: 90.8929 bits (224), Expect = 6.955e-18
Identity = 54/131 (41.22%), Postives = 78/131 (59.54%), Query Frame = 2
Query:  296 DRTLLHVAASCGHPEVVEILLSVDESANVVNAVDEEGWAPIHSAASIGNVTIVEMLLSKGADVNLKNDGGRTALHYAASKGWLKIVELLISRGAKINSKDKVGCTALHRGASTGNSALC-ELLIEEGAEVD 685
            DR  +H AA  GH EVV++L+S       V   D++ + P+H+AAS G +++V+ LL  G D+N  N  G T LH A   G   +V  LI  GA +N K++ G T LH  A++ + ALC ELL+  GA+V+
Sbjct:  206 DRRAIHWAAYMGHIEVVKLLVSHGAE---VTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGAIVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVN 333          

HSP 2 Score: 84.7297 bits (208), Expect = 4.985e-16
Identity = 47/135 (34.81%), Postives = 77/135 (57.04%), Query Frame = 2
Query:  284 RNDDDRTLLHVAASCGHPEVVEILLSVDESANVVNAVDEEGWAPIHSAASIGNVTIVEMLLSKGADVNLKNDGGRTALHYAASKGWLKIVELLISRGAKINSKDKVGCTALHRGASTGNSALCELLIEEGAEVDA 688
            ++++ RT LH AA  G  E++E+L+    S   VNA D +   P+H A +  +   V++LL   ADVN ++   +T LH AA+   +K  E L+   + +N  D+ G TALH  A +G+  + +LL+  GA ++A
Sbjct:   70 QDNEKRTPLHAAAYLGDAEIIELLIL---SGARVNAKDSKWLTPLHRAVASCSEEAVQVLLKHSADVNARDKNWQTPLHIAAANKAVKCAEALVPLLSNVNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINA 201          

HSP 3 Score: 84.3445 bits (207), Expect = 6.510e-16
Identity = 51/129 (39.53%), Postives = 75/129 (58.14%), Query Frame = 2
Query:  299 RTLLHVAASCGHPEVVEILLSVDESANVVNAVDEEGWAPIHSAASIGNVTIVEMLLSKGADVNLKNDGGRTALHYAASKGWLKIVELLISRGAKINSKDKVGCTALHRGASTGNSALCELLIEEGAEVD 685
            RT LH AA  GH E+V++LLS    AN+ NA D++    IH AA +G++ +V++L+S GA+V  K+    T LH AAS G + +V+ L+  G  +N  +  G T LH     G   +   LI+ GA V+
Sbjct:  174 RTALHHAAFSGHGEMVKLLLS--RGANI-NAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMNEPNAYGNTPLHVACYNGQDVVVNELIDCGAIVN 299          

HSP 4 Score: 82.8037 bits (203), Expect = 1.894e-15
Identity = 47/130 (36.15%), Postives = 71/130 (54.62%), Query Frame = 2
Query:  299 RTLLHVAASCGHPEVVEILLSVDESANVVNAVDEEGWAPIHSAASIGNVTIVEMLLSKGADVNLKNDGGRTALHYAASKGWLKIVELLISRGAKINSKDKVGCTALHRGASTGNSALCELLIEEGAEVDA 688
            RT +H AA+ GH E + +L+   E  N V+  D  G  P+  +   G+   V  LL+KGA+V+ K+  GRTALH  A  G  + V+ L+  GAK   +D  G T +H  A+ G+  +   L++  A +DA
Sbjct:  651 RTPIHAAATNGHSECLRLLIGNAEPQNAVDIQDGNGQTPLMLSVLNGHTDCVYSLLNKGANVDAKDKWGRTALHRGAVTGHEECVDALLQHGAKCLLRDSRGRTPIHLSAACGHIGVLGALLQSAASMDA 780          

HSP 5 Score: 81.6481 bits (200), Expect = 4.220e-15
Identity = 46/134 (34.33%), Postives = 82/134 (61.19%), Query Frame = 2
Query:  284 RNDDDRTLLHVAASCGHPEVVEILLSVDESANVVNAVDEEGWAPIHSAASIGNVTIVEMLLSKGADVNLKNDGGRTALHYAASKGWLKIVELLISRGAKINSKDKVGCTALHRGASTGNSALCELLIEEGAEVD 685
            R+ + +T LH+AA+    +  E L+ +  + NV    D  G   +H AA  G+  +V++LLS+GA++N  +   R A+H+AA  G +++V+LL+S GA++  KDK   T LH  AS+G  ++ + L++ G +++
Sbjct:  136 RDKNWQTPLHIAAANKAVKCAEALVPLLSNVNVS---DRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEVTCKDKKSYTPLHAAASSGMISVVKYLLDLGVDMN 266          

HSP 6 Score: 80.8777 bits (198), Expect = 7.198e-15
Identity = 53/127 (41.73%), Postives = 76/127 (59.84%), Query Frame = 2
Query:  302 TLLHVAASCGHPEVVEILLSVDESANVVNAVDEEGWAPIHSAASIGNVTIVEMLLSKGADVNLKNDGGRTALHYAASKGWLKIVELLISRGAKINSKDKVGCTALHRGASTGNSALCELLIEEGAEV 682
            T LH A +    E V++LL    SA+V NA D+    P+H AA+   V   E L+   ++VN+ +  GRTALH+AA  G  ++V+LL+SRGA IN+ DK    A+H  A  G+  + +LL+  GAEV
Sbjct:  109 TPLHRAVASCSEEAVQVLLK--HSADV-NARDKNWQTPLHIAAANKAVKCAEALVPLLSNVNVSDRAGRTALHHAAFSGHGEMVKLLLSRGANINAFDKKDRRAIHWAAYMGHIEVVKLLVSHGAEV 232          

HSP 7 Score: 78.1814 bits (191), Expect = 4.665e-14
Identity = 49/127 (38.58%), Postives = 69/127 (54.33%), Query Frame = 2
Query:  302 TLLHVAASCGHPEVVEILLSVDESANVVNAVDEEGWAPIH-SAASIGNVTIVEMLLSKGADVNLKNDGGRTALHYAASKGWLKIVELLISRGAKINSKDKVGCTALHRGASTGNSALCELLIEEGAE 679
            T LHVA   G   VV  L+   +   +VN  +E+G+ P+H +AAS      +E+L+  GADVN+K+  G+T LH  A  G     + +I  GA I+ +DK G T LH  A  G+  L   LI  GA+
Sbjct:  274 TPLHVACYNGQDVVVNELI---DCGAIVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVIDCEDKNGNTPLHIAARYGHELLINTLITSGAD 397          

HSP 8 Score: 76.6406 bits (187), Expect = 1.357e-13
Identity = 52/129 (40.31%), Postives = 67/129 (51.94%), Query Frame = 2
Query:  302 TLLHVAASCGHPEVVEILLSVDESANVVNAVDEEGWAPIHSAASIGNVTIVEMLLSKGADVNLKNDGGRTALHYAA-SKGWLKIVELLISRGAKINSKDKVGCTALHRGASTGNSALCELLIEEGAEVD 685
            T LH AAS G   VV+ LL +    N  NA    G  P+H A   G   +V  L+  GA VN KN+ G T LH+AA S      +ELL+  GA +N K K G T LH  A  G  +  + +I+ GA +D
Sbjct:  241 TPLHAAASSGMISVVKYLLDLGVDMNEPNAY---GNTPLHVACYNGQDVVVNELIDCGAIVNQKNEKGFTPLHFAAASTHGALCLELLVGNGADVNMKSKDGKTPLHMTALHGRFSRSQTIIQSGAVID 366          

HSP 9 Score: 73.1738 bits (178), Expect = 1.501e-12
Identity = 47/130 (36.15%), Postives = 68/130 (52.31%), Query Frame = 2
Query:  302 TLLHVAASCGHPEVVEILLS--VDESANVVNAVDEEGWAPIHSAASIGNVTIVEMLLSKGADVNLKNDGGRTALHYAASKGWLKIVELLISRGAKINSKDKVGCTALHRGASTGNSALCELLIEEGAEVD 685
            T LH+AA  GH  ++  L++   D +   ++     G  P+H AA  G       LLS G D++  +D GRT LH AA+ G L+ + LL++ GA  N KDK G + LH  A+  N      L+  GA V+
Sbjct:  374 TPLHIAARYGHELLINTLITSGADTAKRGIH-----GMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNKKDKFGRSPLHYAAANCNYQCLFALVGSGASVN 498          

HSP 10 Score: 73.1738 bits (178), Expect = 1.501e-12
Identity = 45/124 (36.29%), Postives = 68/124 (54.84%), Query Frame = 2
Query:  308 LHVAASCGHPEVVEILLSVDESANVVNAVDEEGWAPIHSAASIGNVTIVEMLLSKGADVNLKNDGGRTALHYAASKGWLKIVELLISRGAKINSKDKVGCTALHRGASTGNSALC-ELLIEEGA 676
            LH+AA  G  +    LLS   S   ++  D+ G   +H+AA+ GN+  + +LL+ GAD N K+  GR+ LHYAA+    + +  L+  GA +N  D+ GCT LH  A++     C E L+   A
Sbjct:  409 LHLAALSGFSDCCRKLLS---SGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGADFNKKDKFGRSPLHYAAANCNYQCLFALVGSGASVNDLDERGCTPLHYAATSDTDGKCLEYLLRNDA 529          

HSP 11 Score: 68.1662 bits (165), Expect = 4.828e-11
Identity = 41/132 (31.06%), Postives = 66/132 (50.00%), Query Frame = 2
Query:  284 RNDDDRTLLHVAASCGHPEVVEILLSVDESANVVNAVDEEGWAPIHSAASIGNVTIVEMLLSKGADVNLKNDGGRTALHYAASKGWLKIVELLISRGAKINSKDKVGCTALHRGASTGNSALCELLIEEGAE 679
            ++ D +T LH+ A  G     + ++   +S  V++  D+ G  P+H AA  G+  ++  L++ GAD   +   G   LH AA  G+      L+S G  I++ D  G T LH  A+ GN     LL+  GA+
Sbjct:  335 KSKDGKTPLHMTALHGRFSRSQTII---QSGAVIDCEDKNGNTPLHIAARYGHELLINTLITSGADTAKRGIHGMFPLHLAALSGFSDCCRKLLSSGFDIDTPDDFGRTCLHAAAAGGNLECLNLLLNTGAD 463          
The following BLAST results are available for this feature:
BLAST of FC920380 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 208
Match NameE-valueIdentityDescription
PSD10_RAT1.225e-2246.0326S proteasome non-ATPase regulatory subunit 10 OS... [more]
PSD10_HUMAN1.225e-2246.0326S proteasome non-ATPase regulatory subunit 10 OS... [more]
PSD10_MOUSE2.089e-2246.0326S proteasome non-ATPase regulatory subunit 10 OS... [more]
PSD10_DICDI2.310e-2142.6526S proteasome non-ATPase regulatory subunit 10 OS... [more]
Y381_RICFE1.268e-1937.78Putative ankyrin repeat protein RF_0381 OS=Rickett... [more]
Y045_METMA8.216e-1938.81Putative ankyrin repeat protein MM_0045 OS=Methano... [more]
ANR52_DANRE1.073e-1840.46Serine/threonine-protein phosphatase 6 regulatory ... [more]
ANR28_MOUSE3.122e-1841.22Serine/threonine-protein phosphatase 6 regulatory ... [more]
ANR44_CHICK4.078e-1841.22Serine/threonine-protein phosphatase 6 regulatory ... [more]
ANR28_HUMAN6.955e-1841.22Serine/threonine-protein phosphatase 6 regulatory ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32007F01EF RVDevelop1 Citrus clementina cDNA clone C32007F01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920380 ID=FC920380|Name=FC920380|organism=Citrus clementina|type=EST|length=691bp
GGGGAAGGAGTAAAGTGACGAACCGCGCACCGGGTGAGAACCGGACACAA
CCGAACCGCACCATACCATTGCGCACCGCTTTCGACTTGCAACTAGCTCG
CCGCTGGACCAAATCACACCGTCAAAACTCTAATTCTCGGCAAATTGACA
GTACAATTCCGGTATGGACATGGACATCGATCAAACAATCAAGGACAAAG
ACCTCTTCAAAGCCGCCGAAACTGGAGATTCCTCAACATTCAAATCCCTC
TCAAAACAGCAGCTCTTAAAATCTCTCTCCTTGCGGAACGACGACGACCG
CACCCTCCTCCACGTCGCCGCCTCATGTGGTCACCCCGAGGTGGTGGAAA
TATTGTTGAGTGTTGATGAGTCGGCGAATGTAGTAAACGCTGTTGATGAA
GAAGGGTGGGCTCCGATTCATTCTGCGGCTAGCATTGGCAATGTGACAAT
CGTGGAAATGTTGTTAAGCAAAGGAGCTGATGTAAATTTGAAGAATGATG
GTGGGCGAACCGCTCTTCACTATGCTGCCAGCAAGGGATGGTTGAAGATT
GTGGAACTTCTGATCTCACGTGGTGCAAAAATTAACTCCAAGGACAAGGT
TGGTTGCACAGCATTGCACCGGGGAGCTAGTACAGGGAATTCAGCATTGT
GTGAACTCTTAATTGAAGAAGGAGCAGAGGTTGATGCTACT
back to top