FC920383

Overview
NameFC920383
Unique NameFC920383
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length579
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15452 contig Ccv1_Contig15452:2..580. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920383 vs. ExPASy Swiss-Prot
Match: CATA3_MAIZE (Catalase isozyme 3 OS=Zea mays GN=CAT3 PE=2 SV=2)

HSP 1 Score: 293.893 bits (751), Expect = 3.777e-79
Identity = 135/165 (81.82%), Postives = 149/165 (90.30%), Query Frame = 3
Query:   84 IAMDPYKLLPSTTHNAPFMTTNAGAPVWNDNHSLTVGSRGPVLLEDYHLVEKLAHFARERIPERVVHARGASAKGFFECTHDISHLTCADLFRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNWDLLGNSIPVFFIRDAIKFPDVIHAF*PNPK 578
            + MDP K  PS++H+    TTNAGAPVWNDN +LTVG RGP+LLEDYHL+EK+AHFARERIPERVVHARGASAKGFFECTHD++ LTCAD  RAPGV+TPVIVRFSTVIHERGSPET+RDPRGFAVKFYTREGNWDLLGN+ PVFFIRD IKFPDVIHAF PNP+
Sbjct:    1 MTMDPTKFRPSSSHDTTVTTTNAGAPVWNDNEALTVGPRGPILLEDYHLIEKVAHFARERIPERVVHARGASAKGFFECTHDVTSLTCADFLRAPGVRTPVIVRFSTVIHERGSPETIRDPRGFAVKFYTREGNWDLLGNNFPVFFIRDGIKFPDVIHAFKPNPR 165          
BLAST of FC920383 vs. ExPASy Swiss-Prot
Match: CATA_PHAAU (Catalase OS=Phaseolus aureus PE=2 SV=1)

HSP 1 Score: 291.197 bits (744), Expect = 2.448e-78
Identity = 134/163 (82.21%), Postives = 151/163 (92.64%), Query Frame = 3
Query:   90 MDPYKLLPSTTHNAPFMTTNAGAPVWNDNHSLTVGSRGPVLLEDYHLVEKLAHFARERIPERVVHARGASAKGFFECTHDISHLTCADLFRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNWDLLGNSIPVFFIRDAIKFPDVIHAF*PNPK 578
            MDPYK  PS+  N+PF TTN+GAPVWN+N+SLTVG+RGP+LLEDYHLVEKLA+F RERIPERVVHARGASAKGFFE THD+SHLTCAD  RAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGN+DL+GN++PVFF+RD +KFPD++HA  PNPK
Sbjct:    1 MDPYKYRPSSAFNSPFWTTNSGAPVWNNNNSLTVGTRGPILLEDYHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNLPVFFVRDGMKFPDMVHALKPNPK 163          
BLAST of FC920383 vs. ExPASy Swiss-Prot
Match: CATA1_RICCO (Catalase isozyme 1 OS=Ricinus communis GN=CAT1 PE=2 SV=2)

HSP 1 Score: 291.197 bits (744), Expect = 2.448e-78
Identity = 136/163 (83.44%), Postives = 149/163 (91.41%), Query Frame = 3
Query:   90 MDPYKLLPSTTHNAPFMTTNAGAPVWNDNHSLTVGSRGPVLLEDYHLVEKLAHFARERIPERVVHARGASAKGFFECTHDISHLTCADLFRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNWDLLGNSIPVFFIRDAIKFPDVIHAF*PNPK 578
            MDPY+  PS+  N PF TTN+GAPVWN+N SLTVGSRGP+LLEDYHL+EKLA+F RERIPERVVHARGASAKGFFE THD+SHLTCAD  RAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGN+DL+GN+ PVFFIRD +KFPDV+HAF PNPK
Sbjct:    1 MDPYRNRPSSGFNTPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLIEKLANFDRERIPERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDVVHAFKPNPK 163          
BLAST of FC920383 vs. ExPASy Swiss-Prot
Match: CATA4_SOYBN (Catalase-4 OS=Glycine max GN=CAT4 PE=2 SV=1)

HSP 1 Score: 289.656 bits (740), Expect = 7.122e-78
Identity = 134/163 (82.21%), Postives = 150/163 (92.02%), Query Frame = 3
Query:   90 MDPYKLLPSTTHNAPFMTTNAGAPVWNDNHSLTVGSRGPVLLEDYHLVEKLAHFARERIPERVVHARGASAKGFFECTHDISHLTCADLFRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNWDLLGNSIPVFFIRDAIKFPDVIHAF*PNPK 578
            MDPYK  PS+  N+PF TTN+GAP+WN+N SLTVG+RGP+LLEDYHLVEKLA+F RERIPERVVHARGASAKGFFE THDISHLTCAD  RAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGN+DL+GN++PVFF+RD +KFPD++HA  PNPK
Sbjct:    1 MDPYKHRPSSAFNSPFWTTNSGAPIWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNLPVFFVRDGMKFPDMVHALKPNPK 163          
BLAST of FC920383 vs. ExPASy Swiss-Prot
Match: CATA3_SOYBN (Catalase-3 OS=Glycine max GN=CAT3 PE=2 SV=1)

HSP 1 Score: 289.271 bits (739), Expect = 9.302e-78
Identity = 134/163 (82.21%), Postives = 149/163 (91.41%), Query Frame = 3
Query:   90 MDPYKLLPSTTHNAPFMTTNAGAPVWNDNHSLTVGSRGPVLLEDYHLVEKLAHFARERIPERVVHARGASAKGFFECTHDISHLTCADLFRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNWDLLGNSIPVFFIRDAIKFPDVIHAF*PNPK 578
            MDPYK  PS+  N+PF TTN+GAP+WN+N SLTVGSRGP+LLEDYHLVEKLA+F RERIPERVVHARGASAKGFFE THDISHLTCAD  RAPGVQTP+IVRFSTVIHERGSPETLRDPRGFAVKFYTREGN+DL+GN+ PVFF+RD +KFPD++HA  PNPK
Sbjct:    1 MDPYKNRPSSAFNSPFWTTNSGAPIWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGLKFPDMVHALKPNPK 163          
BLAST of FC920383 vs. ExPASy Swiss-Prot
Match: CATA1_SOYBN (Catalase-1/2 OS=Glycine max GN=CAT1 PE=2 SV=1)

HSP 1 Score: 289.271 bits (739), Expect = 9.302e-78
Identity = 134/163 (82.21%), Postives = 149/163 (91.41%), Query Frame = 3
Query:   90 MDPYKLLPSTTHNAPFMTTNAGAPVWNDNHSLTVGSRGPVLLEDYHLVEKLAHFARERIPERVVHARGASAKGFFECTHDISHLTCADLFRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNWDLLGNSIPVFFIRDAIKFPDVIHAF*PNPK 578
            MDPYK  PS+  N+PF TTN+GAP+WN+N SLTVGSRGP+LLEDYHLVEKLA+F RERIPERVVHARGASAKGFFE THDISHLTCAD  RAPGVQTP+IVRFSTVIHERGSPETLRDPRGFAVKFYTREGN+DL+GN+ PVFF+RD +KFPD++HA  PNPK
Sbjct:    1 MDPYKNRPSSAFNSPFWTTNSGAPIWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDISHLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGLKFPDMVHALKPNPK 163          
BLAST of FC920383 vs. ExPASy Swiss-Prot
Match: CATA3_NICPL (Catalase isozyme 3 OS=Nicotiana plumbaginifolia GN=CAT3 PE=2 SV=1)

HSP 1 Score: 288.886 bits (738), Expect = 1.215e-77
Identity = 133/163 (81.60%), Postives = 150/163 (92.02%), Query Frame = 3
Query:   90 MDPYKLLPSTTHNAPFMTTNAGAPVWNDNHSLTVGSRGPVLLEDYHLVEKLAHFARERIPERVVHARGASAKGFFECTHDISHLTCADLFRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNWDLLGNSIPVFFIRDAIKFPDVIHAF*PNPK 578
            MDPYK  PS+ +N+PF TTN+GAPVWN+N S+TVG+RGP+LLEDYHLVEKLA+F RERIPERVVHARGASAKGFFE THDI+HLTCAD  RAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGN+DL+GN+ PVFF+RD +KFPD++HA  PNPK
Sbjct:    1 MDPYKYRPSSANNSPFWTTNSGAPVWNNNSSMTVGTRGPILLEDYHLVEKLANFDRERIPERVVHARGASAKGFFEVTHDITHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPK 163          
BLAST of FC920383 vs. ExPASy Swiss-Prot
Match: CATA1_WHEAT (Catalase-1 OS=Triticum aestivum GN=CAT1 PE=2 SV=1)

HSP 1 Score: 288.5 bits (737), Expect = 1.587e-77
Identity = 132/163 (80.98%), Postives = 149/163 (91.41%), Query Frame = 3
Query:   90 MDPYKLLPSTTHNAPFMTTNAGAPVWNDNHSLTVGSRGPVLLEDYHLVEKLAHFARERIPERVVHARGASAKGFFECTHDISHLTCADLFRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNWDLLGNSIPVFFIRDAIKFPDVIHAF*PNPK 578
            MDPYK  PS++ NAP  +TN+GAPVWN+++SLTVGSRGP+LLEDYHLVEK+A F RERIPERVVHARGA+AKGFFE THD+SHLTCAD  RAPGVQTPVIVRFSTVIHERGSPETLRDPRGFA+KFYTREGNWDL+GN+ PVFFIRD +KFPD++HA  PNPK
Sbjct:    1 MDPYKYRPSSSFNAPMWSTNSGAPVWNNDNSLTVGSRGPILLEDYHLVEKIADFDRERIPERVVHARGATAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAIKFYTREGNWDLVGNNFPVFFIRDGMKFPDMVHALKPNPK 163          
BLAST of FC920383 vs. ExPASy Swiss-Prot
Match: CATA1_ORYSJ (Catalase isozyme A OS=Oryza sativa subsp. japonica GN=CATA PE=2 SV=1)

HSP 1 Score: 287.73 bits (735), Expect = 2.706e-77
Identity = 132/163 (80.98%), Postives = 146/163 (89.57%), Query Frame = 3
Query:   90 MDPYKLLPSTTHNAPFMTTNAGAPVWNDNHSLTVGSRGPVLLEDYHLVEKLAHFARERIPERVVHARGASAKGFFECTHDISHLTCADLFRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNWDLLGNSIPVFFIRDAIKFPDVIHAF*PNPK 578
            MDP K  PS++ +    TTNAGAPVWNDN +LTVG RGP+LLEDYHL+EK+AHFARERIPERVVHARGASAKGFFECTHD++ +TCAD  R+PG QTPVIVRFSTVIHERGSPET+RDPRGFAVKFYTREGNWDLLGN+ PVFFIRD IKFPDVIHAF PNP+
Sbjct:    1 MDPCKFRPSSSFDTKTTTTNAGAPVWNDNEALTVGPRGPILLEDYHLIEKVAHFARERIPERVVHARGASAKGFFECTHDVTDITCADFLRSPGAQTPVIVRFSTVIHERGSPETIRDPRGFAVKFYTREGNWDLLGNNFPVFFIRDGIKFPDVIHAFKPNPR 163          
BLAST of FC920383 vs. ExPASy Swiss-Prot
Match: CATA1_ORYSI (Catalase isozyme A OS=Oryza sativa subsp. indica PE=2 SV=1)

HSP 1 Score: 287.73 bits (735), Expect = 2.706e-77
Identity = 132/163 (80.98%), Postives = 146/163 (89.57%), Query Frame = 3
Query:   90 MDPYKLLPSTTHNAPFMTTNAGAPVWNDNHSLTVGSRGPVLLEDYHLVEKLAHFARERIPERVVHARGASAKGFFECTHDISHLTCADLFRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNWDLLGNSIPVFFIRDAIKFPDVIHAF*PNPK 578
            MDP K  PS++ +    TTNAGAPVWNDN +LTVG RGP+LLEDYHL+EK+AHFARERIPERVVHARGASAKGFFECTHD++ +TCAD  R+PG QTPVIVRFSTVIHERGSPET+RDPRGFAVKFYTREGNWDLLGN+ PVFFIRD IKFPDVIHAF PNP+
Sbjct:    1 MDPCKFRPSSSFDTKTTTTNAGAPVWNDNEALTVGPRGPILLEDYHLIEKVAHFARERIPERVVHARGASAKGFFECTHDVTDITCADFLRSPGAQTPVIVRFSTVIHERGSPETIRDPRGFAVKFYTREGNWDLLGNNFPVFFIRDGIKFPDVIHAFKPNPR 163          
The following BLAST results are available for this feature:
BLAST of FC920383 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 141
Match NameE-valueIdentityDescription
CATA3_MAIZE3.777e-7981.82Catalase isozyme 3 OS=Zea mays GN=CAT3 PE=2 SV=2[more]
CATA_PHAAU2.448e-7882.21Catalase OS=Phaseolus aureus PE=2 SV=1[more]
CATA1_RICCO2.448e-7883.44Catalase isozyme 1 OS=Ricinus communis GN=CAT1 PE=... [more]
CATA4_SOYBN7.122e-7882.21Catalase-4 OS=Glycine max GN=CAT4 PE=2 SV=1[more]
CATA3_SOYBN9.302e-7882.21Catalase-3 OS=Glycine max GN=CAT3 PE=2 SV=1[more]
CATA1_SOYBN9.302e-7882.21Catalase-1/2 OS=Glycine max GN=CAT1 PE=2 SV=1[more]
CATA3_NICPL1.215e-7781.60Catalase isozyme 3 OS=Nicotiana plumbaginifolia GN... [more]
CATA1_WHEAT1.587e-7780.98Catalase-1 OS=Triticum aestivum GN=CAT1 PE=2 SV=1[more]
CATA1_ORYSJ2.706e-7780.98Catalase isozyme A OS=Oryza sativa subsp. japonica... [more]
CATA1_ORYSI2.706e-7780.98Catalase isozyme A OS=Oryza sativa subsp. indica P... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionC32007F04EF RVDevelop1 Citrus clementina cDNA clone C32007F04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920383 ID=FC920383|Name=FC920383|organism=Citrus clementina|type=EST|length=579bp
GACACTCTTCTTGAGTCTCGACTCAACTCCACTTCTCCTTTCTTACGATA
ATAATAACAGTAGCAAAATCTTCAGCAAGAAATATCGCCATGGATCCCTA
CAAATTGCTTCCGTCAACTACTCACAATGCCCCCTTTATGACTACAAATG
CCGGCGCTCCTGTCTGGAACGACAATCACTCCTTGACTGTTGGAAGTAGA
GGTCCTGTCCTTCTTGAGGATTATCATCTGGTGGAGAAACTAGCTCATTT
TGCCAGGGAGAGGATTCCAGAACGTGTCGTCCATGCTAGGGGAGCCAGTG
CTAAGGGTTTCTTTGAGTGCACCCATGATATTTCTCACCTTACTTGTGCT
GATCTTTTTCGAGCTCCAGGGGTTCAGACACCTGTCATTGTTCGCTTCTC
CACTGTTATCCATGAGCGGGGCAGCCCTGAGACACTCAGGGATCCTCGAG
GATTTGCAGTCAAGTTTTACACCAGAGAGGGTAATTGGGATCTTCTGGGT
AACAGTATCCCTGTTTTTTTCATCCGTGATGCAATCAAATTCCCAGATGT
GATCCATGCTTTCTAACCTAATCCAAAGT
back to top