FC920393

Overview
NameFC920393
Unique NameFC920393
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length697
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig4005 contig Ccv1_Contig4005:29..725. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920393 vs. ExPASy Swiss-Prot
Match: ILV5_ARATH (Ketol-acid reductoisomerase, chloroplastic OS=Arabidopsis thaliana GN=At3g58610 PE=2 SV=2)

HSP 1 Score: 266.929 bits (681), Expect = 7.142e-71
Identity = 142/199 (71.36%), Postives = 158/199 (79.40%), Query Frame = 3
Query:  111 NLAFFSSTAKSLRALKTT----RGRGSALGAQMASETALKTPFLLDFETSVFKKDAISLANRDEFIVRGGRDLFKLLPDAFNGINQIGVIGWGSQGPAQAQNLRDSLAEAKSDIVVKVGLRKGSRSFAEARAAGFTEENGTLGDIYETISGSDLVLLLISDAAQADNYEKIFSCMKPNSIXXXXXXXXXXXXXVMGLDF 695
            N+ F SS++KSLR+L  T       GS+L A+M S +A+K P  LDFETSVFKK+ +SLA  +E+IVRGGRDLFK LPDAF GI QIGVIGWGSQGPAQAQNLRDSL EAKSDIVVK+GLRKGSRSF EARAAGFTEE+GTLGDI+ETI+GSDLVLLLISDAAQADNYEKIFS MKPNSI               GLDF
Sbjct:   36 NIGFLSSSSKSLRSLTATVAGNGATGSSLAARMVSSSAVKAPVSLDFETSVFKKEKVSLAGYEEYIVRGGRDLFKHLPDAFKGIKQIGVIGWGSQGPAQAQNLRDSLVEAKSDIVVKIGLRKGSRSFEEARAAGFTEESGTLGDIWETIAGSDLVLLLISDAAQADNYEKIFSHMKPNSILGLSHGFLLGHLQSSGLDF 234          
BLAST of FC920393 vs. ExPASy Swiss-Prot
Match: ILV5_SPIOL (Ketol-acid reductoisomerase, chloroplastic OS=Spinacia oleracea GN=AHRI PE=1 SV=1)

HSP 1 Score: 249.595 bits (636), Expect = 1.180e-65
Identity = 135/207 (65.22%), Postives = 156/207 (75.36%), Query Frame = 3
Query:  108 LNLAFF--SSTAKSLRALKTTR-------GRGSALGAQMASETALKTPFL--LDFETSVFKKDAISLANRDEFIVRGGRDLFKLLPDAFNGINQIGVIGWGSQGPAQAQNLRDSLAEAKSDIVVKVGLRKGSRSFAEARAAGFTEENGTLGDIYETISGSDLVLLLISDAAQADNYEKIFSCMKPNSIXXXXXXXXXXXXXVMGLDF 695
            LNL F   SST K+ R+LK  R       G GSAL AQM S  ++ TP     DF++SVFKK+ ++L+  DE+IVRGGR+LF LLPDAF GI QIGVIGWGSQ PAQAQNL+DSL EAKSD+VVK+GLRKGS SFAEARAAGF+EENGTLGD++ETISGSDLVLLLISD+AQADNYEK+FS MKPNSI              +G DF
Sbjct:   34 LNLGFLGSSSTIKACRSLKAARVLPSGANGGGSALSAQMVSAPSINTPSATTFDFDSSVFKKEKVTLSGHDEYIVRGGRNLFPLLPDAFKGIKQIGVIGWGSQAPAQAQNLKDSLTEAKSDVVVKIGLRKGSNSFAEARAAGFSEENGTLGDMWETISGSDLVLLLISDSAQADNYEKVFSHMKPNSILGLSHGFLLGHLQSLGQDF 240          
BLAST of FC920393 vs. ExPASy Swiss-Prot
Match: ILV5_PEA (Ketol-acid reductoisomerase, chloroplastic OS=Pisum sativum GN=PGAAIR PE=2 SV=1)

HSP 1 Score: 247.284 bits (630), Expect = 5.856e-65
Identity = 134/200 (67.00%), Postives = 151/200 (75.50%), Query Frame = 3
Query:   96 AFKHLNLAFFSSTAKSLRALKTTRGRGSALGAQMASETALKTPFLLDFETSVFKKDAISLANRDEFIVRGGRDLFKLLPDAFNGINQIGVIGWGSQGPAQAQNLRDSLAEAKSDIVVKVGLRKGSRSFAEARAAGFTEENGTLGDIYETISGSDLVLLLISDAAQADNYEKIFSCMKPNSIXXXXXXXXXXXXXVMGLDF 695
            +F   NL+F   + +S+RA ++    GSALGA   S      P  LDFETSVFKK+ ++LA  +E+IVRGGRDLF LLPDAF GI QIGVIGWGSQGPAQAQNLRDSL EAKSDIVVKVGLRKGS SF EAR AGF+EE GTLGDI+ETISGSDLVLLLISD+AQADNYEKIFS +KPNSI              +GLDF
Sbjct:   26 SFAPTNLSFSKLSPQSIRARRSITV-GSALGATKVSAPPATHPVSLDFETSVFKKERVNLAGHEEYIVRGGRDLFHLLPDAFKGIKQIGVIGWGSQGPAQAQNLRDSLVEAKSDIVVKVGLRKGSSSFNEAREAGFSEEKGTLGDIWETISGSDLVLLLISDSAQADNYEKIFSHLKPNSILGLSHGFLLGHLQSIGLDF 224          
BLAST of FC920393 vs. ExPASy Swiss-Prot
Match: ILV5_ORYSJ (Ketol-acid reductoisomerase, chloroplastic OS=Oryza sativa subsp. japonica GN=Os05g0573700 PE=1 SV=1)

HSP 1 Score: 233.802 bits (595), Expect = 6.701e-61
Identity = 126/183 (68.85%), Postives = 140/183 (76.50%), Query Frame = 3
Query:  147 RALKTTRGRGSALGAQMASETALKTPFLLDFETSVFKKDAISLANRDEFIVRGGRDLFKLLPDAFNGINQIGVIGWGSQGPAQAQNLRDSLAEAKSDIVVKVGLRKGSRSFAEARAAGFTEENGTLGDIYETISGSDLVLLLISDAAQADNYEKIFSCMKPNSIXXXXXXXXXXXXXVMGLDF 695
            RA+        A+GA M S         LDF+TSVF K+ +SLA  +E+IVRGGR+LF LLP+AF GI QIGVIGWGSQGPAQAQNLRDSLAEAKSDIVVK+GLRKGS+SF EARAAGFTEE+GTLGDI+ET+SGSDLVLLLISDAAQADNYEKIFS MKPNSI               GLDF
Sbjct:   49 RAVTAMVAAPPAVGAAMPS---------LDFDTSVFNKEKVSLAGHEEYIVRGGRNLFPLLPEAFKGIKQIGVIGWGSQGPAQAQNLRDSLAEAKSDIVVKIGLRKGSKSFDEARAAGFTEESGTLGDIWETVSGSDLVLLLISDAAQADNYEKIFSHMKPNSILGLSHGFLLGHLQSAGLDF 222          
The following BLAST results are available for this feature:
BLAST of FC920393 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
ILV5_ARATH7.142e-7171.36Ketol-acid reductoisomerase, chloroplastic OS=Arab... [more]
ILV5_SPIOL1.180e-6565.22Ketol-acid reductoisomerase, chloroplastic OS=Spin... [more]
ILV5_PEA5.856e-6567.00Ketol-acid reductoisomerase, chloroplastic OS=Pisu... [more]
ILV5_ORYSJ6.701e-6168.85Ketol-acid reductoisomerase, chloroplastic OS=Oryz... [more]
back to top
Properties
Property NameValue
Genbank descriptionC32007G04EF RVDevelop1 Citrus clementina cDNA clone C32007G04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920393 ID=FC920393|Name=FC920393|organism=Citrus clementina|type=EST|length=697bp
GGAGTCAAAAAAACAAAATGGTCGCGGGTACTTTACCATCTAGTCCGTCG
ATCCCCAAATTTAGTCCATCGCCGTCGTCCGAAACCCTAAAAGGAGCATT
CAAGCATCTCAATCTAGCGTTTTTCTCATCCACCGCGAAGTCCTTGAGAG
CTCTCAAAACTACCAGAGGCAGGGGCTCAGCTCTCGGCGCTCAGATGGCG
TCCGAGACAGCTCTCAAGACACCTTTCTTGCTGGATTTTGAGACATCCGT
CTTTAAGAAGGACGCGATATCACTGGCTAACCGCGATGAGTTCATTGTGA
GAGGAGGAAGGGATTTGTTTAAGTTGCTGCCGGACGCATTCAACGGGATT
AACCAGATTGGGGTGATTGGCTGGGGTTCCCAGGGACCTGCCCAAGCTCA
GAATTTGAGGGATTCCCTTGCTGAAGCTAAATCTGATATTGTTGTCAAGG
TTGGGCTTAGGAAGGGCTCTCGTTCTTTTGCTGAAGCTCGTGCTGCTGGT
TTTACTGAAGAGAATGGAACTTTGGGGGATATATATGAAACTATTTCAGG
CAGTGATCTTGTGTTATTGTTGATTTCTGATGCTGCTCAGGCAGATAATT
ATGAGAAGATATTCTCTTGCATGAAACCAAACAGCATCCTTGGACTTTCC
CATGGGTTTCTTCTTGGGCATTTGCANGTCATGGGACTTGATTTCCC
back to top