FC920397

Overview
NameFC920397
Unique NameFC920397
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length710
Libraries
Library NameType
RVDevelop1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14134 contig Ccv1_Contig14134:1..710. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC920397 vs. ExPASy Swiss-Prot
Match: DHBB_BACSU (Isochorismatase OS=Bacillus subtilis GN=dhbB PE=1 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 1.093e-13
Identity = 56/175 (32.00%), Postives = 86/175 (49.14%), Query Frame = 3
Query:  207 PNPKSSVLLVIDMQNHF----SSIAKPILD---NTLATVQLCRRASIPVFFTRHC-HKSPADYGMLGEWWNGDL---VYDGTADAELLPEIKGLVAGADEVIEKNTYSAFGNTRLQERLVGMGVEEVIVCGVMTNLCCETTARDAFLRGFRVFFSTDATATSDLELHEATLKNLA 698
            P+P  +VLL+ DMQN+F    ++ A P+ +   N       C +  IPV +T     ++P D  +L ++W   L    Y+     EL PE        D V+ K  YSAF  T L E +   G +++I+ G+  ++ C  TA +AF+   + FF  DA A   LE H+  L+  A
Sbjct:   26 PDPNRAVLLIHDMQNYFVDAFTAGASPVTELSANIRKLKNQCVQLGIPVVYTAQPGSQNPDDRALLTDFWGPGLNSGPYEEKIITELAPE------DDDLVLTKWRYSAFKRTNLLEMMRKEGRDQLIITGIYAHIGCLVTACEAFMEDIKAFFVGDAVADFSLEKHQMALEYAA 194          
BLAST of FC920397 vs. ExPASy Swiss-Prot
Match: ENTB_SHIFL (Isochorismatase OS=Shigella flexneri GN=entB PE=3 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 2.434e-13
Identity = 53/171 (30.99%), Postives = 86/171 (50.29%), Query Frame = 3
Query:  213 PKSSVLLVIDMQNHFSS-------IAKPILDNTLATVQLCRRASIPVFFTRHC-HKSPADYGMLGEWWNGDLVYDGTADAELLPEIKGLVAGADE-VIEKNTYSAFGNTRLQERLVGMGVEEVIVCGVMTNLCCETTARDAFLRGFRVFFSTDATATSDLELHEATLKNLA 698
            P+ + LL+ DMQ++F S       + + ++ N  A    C++ +IPV++T     +S  D  +L + W   L    T   E    +  L   AD+ V+ K  YSAF  + L++ L   G  ++I+ GV  ++ C TTA DAF+R  + F   DA A    + H  +LK +A
Sbjct:   28 PQRAALLIHDMQDYFVSFWGENCPMMEQVIANIAALRDYCKQHNIPVYYTAQPKEQSDEDRALLNDMWGPGL----TRSPEQQKVVDRLTPDADDTVLVKWRYSAFHRSPLEQMLKESGRNQLIITGVYAHIGCMTTATDAFMRDIKPFMVADALADFSRDEHLMSLKYVA 194          
BLAST of FC920397 vs. ExPASy Swiss-Prot
Match: ENTB_ECOLI (Isochorismatase OS=Escherichia coli (strain K12) GN=entB PE=1 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 2.434e-13
Identity = 53/171 (30.99%), Postives = 86/171 (50.29%), Query Frame = 3
Query:  213 PKSSVLLVIDMQNHFSS-------IAKPILDNTLATVQLCRRASIPVFFTRHC-HKSPADYGMLGEWWNGDLVYDGTADAELLPEIKGLVAGADE-VIEKNTYSAFGNTRLQERLVGMGVEEVIVCGVMTNLCCETTARDAFLRGFRVFFSTDATATSDLELHEATLKNLA 698
            P+ + LL+ DMQ++F S       + + ++ N  A    C++ +IPV++T     +S  D  +L + W   L    T   E    +  L   AD+ V+ K  YSAF  + L++ L   G  ++I+ GV  ++ C TTA DAF+R  + F   DA A    + H  +LK +A
Sbjct:   28 PQRAALLIHDMQDYFVSFWGENCPMMEQVIANIAALRDYCKQHNIPVYYTAQPKEQSDEDRALLNDMWGPGL----TRSPEQQKVVDRLTPDADDTVLVKWRYSAFHRSPLEQMLKESGRNQLIITGVYAHIGCMTTATDAFMRDIKPFMVADALADFSRDEHLMSLKYVA 194          
BLAST of FC920397 vs. ExPASy Swiss-Prot
Match: ENTB_ECO57 (Isochorismatase OS=Escherichia coli O157:H7 GN=entB PE=3 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 2.434e-13
Identity = 53/171 (30.99%), Postives = 86/171 (50.29%), Query Frame = 3
Query:  213 PKSSVLLVIDMQNHFSS-------IAKPILDNTLATVQLCRRASIPVFFTRHC-HKSPADYGMLGEWWNGDLVYDGTADAELLPEIKGLVAGADE-VIEKNTYSAFGNTRLQERLVGMGVEEVIVCGVMTNLCCETTARDAFLRGFRVFFSTDATATSDLELHEATLKNLA 698
            P+ + LL+ DMQ++F S       + + ++ N  A    C++ +IPV++T     +S  D  +L + W   L    T   E    +  L   AD+ V+ K  YSAF  + L++ L   G  ++I+ GV  ++ C TTA DAF+R  + F   DA A    + H  +LK +A
Sbjct:   28 PQRAALLIHDMQDYFVSFWGENCPMMEQVIANIAALRDYCKQHNIPVYYTAQPKEQSDEDRALLNDMWGPGL----TRSPEQQKVVDRLTPDADDTVLVKWRYSAFHRSPLEQMLKESGRNQLIITGVYAHIGCMTTATDAFMRDIKPFMVADALADFSRDEHLMSLKYVA 194          
The following BLAST results are available for this feature:
BLAST of FC920397 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
DHBB_BACSU1.093e-1332.00Isochorismatase OS=Bacillus subtilis GN=dhbB PE=1 ... [more]
ENTB_SHIFL2.434e-1330.99Isochorismatase OS=Shigella flexneri GN=entB PE=3 ... [more]
ENTB_ECOLI2.434e-1330.99Isochorismatase OS=Escherichia coli (strain K12) G... [more]
ENTB_ECO572.434e-1330.99Isochorismatase OS=Escherichia coli O157:H7 GN=ent... [more]
back to top
Properties
Property NameValue
Genbank descriptionC32007G08EF RVDevelop1 Citrus clementina cDNA clone C32007G08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC920397 ID=FC920397|Name=FC920397|organism=Citrus clementina|type=EST|length=710bp
GAGGCTGATTGAATTTACCCTCCTCTCCTAGAACCACCTAGAAACTCTCG
TATTGTTAATACACTTATGCTCATGTAATTTCAACATTTAAGATCCCATA
CGGCCATACACCAGCAGAAATAATGTCTCTGAGAAGTCAAATCCAACAAG
AAATGGCGACATCAAAGTGTTCATCGTACCAGAAATACGAGATCAGAAAG
AGAAACCCAAATCCCAAATCCTCTGTTTTATTAGTCATTGACATGCAAAA
CCACTTTTCCTCCATAGCCAAACCCATACTCGACAACACTCTCGCCACCG
TCCAGCTCTGCCGACGAGCCTCCATCCCCGTTTTCTTCACGCGCCACTGC
CACAAGTCCCCCGCTGACTACGGCATGCTCGGCGAGTGGTGGAACGGCGA
TCTGGTCTACGACGGCACCGCCGACGCCGAGCTCTTGCCTGAGATCAAAG
GGCTGGTGGCGGGTGCGGACGAGGTCATAGAGAAGAATACTTACAGCGCG
TTTGGTAACACGCGGCTGCAGGAGCGGTTGGTGGGGATGGGGGTGGAGGA
AGTGATCGTGTGTGGTGTTATGACGAACTTGTGCTGCGAAACGACGGCGC
GGGACGCGTTTTTGAGAGGGTTTAGGGTGTTCTTCTCGACGGATGCGACT
GCCACGTCGGATTTGGAGCTGCACGAGGCGACGTTGAAGAATTTGGCTTA
TGGCTTTGCT
back to top