FC924871

Overview
NameFC924871
Unique NameFC924871
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length774
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC924871_ssr636 microsatellite FC924871_ssr636:636..647. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig14550 contig Ccv1_Contig14550:124..897. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC924871 vs. ExPASy Swiss-Prot
Match: STH_ARATH (Salt tolerance-like protein OS=Arabidopsis thaliana GN=STH PE=1 SV=2)

HSP 1 Score: 283.108 bits (723), Expect = 1.149e-75
Identity = 145/227 (63.88%), Postives = 171/227 (75.33%), Query Frame = 3
Query:    3 VICCADEAALCAKCDVEVHAANKLASKHQRLLLQCLSNKLPPCDICQEKAAFIFCVEDRALFCKDCDEPIHSPGSLSANHQRFLATGIRVALSS-SCSKDAERNISEPPNQQASQTSVKMPTQQSSSISSPWAVDDFLQFSDFESSGK-KEQLEFGELEWIADMGIFNDQLPQEALAAAEVPQLPVSQPNNLISSYRPTKFNMPYKKPRIEIP-DDDDEHFTVPDLG 674
            +ICCADEAALCAKCDVEVHAANKLASKHQRL L  LS K PPCDIC EKAAFIFCVEDRAL C+DCDE  H+P + SANHQRFLATGIRVALSS SC+++ E+N  +P NQQ+     K PTQQ ++ S  WA D+F  +SD + S K KEQL+ GEL+W+A+MG+F DQ  QEAL  AEVP+L  S   +  S  RP K N+P KK R+E   DD++EHF VPDLG
Sbjct:   15 LICCADEAALCAKCDVEVHAANKLASKHQRLFLDSLSTKFPPCDICLEKAAFIFCVEDRALLCRDCDEATHAPNTRSANHQRFLATGIRVALSSTSCNQEVEKNHFDPSNQQSLS---KPPTQQPAAPSPLWATDEFFSYSDLDCSNKEKEQLDLGELDWLAEMGLFGDQPDQEALPVAEVPELSFSHLAHAHSYNRPMKSNVPNKKQRLEYRYDDEEEHFLVPDLG 238          
BLAST of FC924871 vs. ExPASy Swiss-Prot
Match: STO_ARATH (Salt tolerance protein OS=Arabidopsis thaliana GN=STO PE=1 SV=1)

HSP 1 Score: 281.952 bits (720), Expect = 2.560e-75
Identity = 148/235 (62.98%), Postives = 174/235 (74.04%), Query Frame = 3
Query:    3 VICCADEAALCAKCDVEVHAANKLASKHQRLLLQCLSNKLPPCDICQEKAAFIFCVEDRALFCKDCDEPIHSPGSLSANHQRFLATGIRVALSSS-CSKDAERNISEPPN--QQASQTSVKMPTQQ----SSSISSPWAVDDFLQFSDFESSGKKEQLEF--GELEWIADMGIFNDQLPQEALAAAEVPQLPVSQPNNLISSYRPTKFNMPYKKPRIE--IPDDDDEHFTVPDLG 674
            VICCADEAALC +CD+E+HAANKLASKHQRL L  LS K P CDICQEKAAFIFCVEDRAL C+DCDE IH   S SANHQRFLATGI+VAL+S+ CSK+ E+N  EP N  Q+A+Q   K  +QQ    SS+   PWAVDDF  FSD ES+ KK QL+   GEL+W +DMG F DQ+  +AL AAEVP+L VS   + + SY+P K N+ +KKPR E    DDD+EHF VPDLG
Sbjct:   15 VICCADEAALCPQCDIEIHAANKLASKHQRLHLNSLSTKFPRCDICQEKAAFIFCVEDRALLCRDCDESIHVANSRSANHQRFLATGIKVALTSTICSKEIEKNQPEPSNNQQKANQIPAKSTSQQQQQPSSATPLPWAVDDFFHFSDIESTDKKGQLDLGAGELDWFSDMGFFGDQINDKALPAAEVPELSVSHLGH-VHSYKPMKSNVSHKKPRFETRYDDDDEEHFIVPDLG 248          
BLAST of FC924871 vs. ExPASy Swiss-Prot
Match: STHY_ARATH (Probable salt tolerance-like protein At1g78600 OS=Arabidopsis thaliana GN=At1g78600 PE=1 SV=2)

HSP 1 Score: 122.479 bits (306), Expect = 2.596e-27
Identity = 68/187 (36.36%), Postives = 94/187 (50.27%), Query Frame = 3
Query:    3 VICCADEAALCAKCDVEVHAANKLASKHQRLLLQCLSNKLPPCDICQEKAAFIFCVEDRALFCKDCDEPIHSPGSLSANHQRFLATGIRVALSS--------SCSKDAERNISEPPNQQA-------------------------------SQTSVKMPTQQSSSISS---PWAVDDFLQFSDFESS 437
            V+CCADEAALC  CD ++HAANKLA KHQR+ L   ++ +P CDICQE + F FC++DRAL C+ CD  IH+     + HQRFL TGI+V L S        S   + ++ +   P  Q+                                QTS K+P   S S +     W +++    +DF+ S
Sbjct:   15 VLCCADEAALCWACDEKIHAANKLAGKHQRVPLSASASSIPKCDICQEASGFFFCLQDRALLCRKCDVAIHTVNPHVSAHQRFLLTGIKVGLESIDTGPSTKSSPTNDDKTMETKPFVQSIPEPQKMAFDHHHHQQQQEQQEGVIPGTKVNDQTSTKLPLVSSGSTTGSIPQWQIEEIFGLTDFDQS 201          
BLAST of FC924871 vs. ExPASy Swiss-Prot
Match: STHX_ARATH (Probable salt tolerance-like protein At1g75540 OS=Arabidopsis thaliana GN=At1g75540 PE=1 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 9.234e-25
Identity = 60/136 (44.12%), Postives = 80/136 (58.82%), Query Frame = 3
Query:    3 VICCADEAALCAKCDVEVHAANKLASKHQR--LLLQCLSNKLPP-CDICQEKAAFIFCVEDRALFCKDCDEPIHSPGSLSANHQRFLATGIRVALSSSCSKDAERNISEPPNQQ---ASQTSVKMPTQQSSSISSP 392
            V C ADEA+LC  CD +VH ANKLASKH R  LL    SN   P CDICQ+K A +FC +DRA+ CKDCD  IH+    +  H RFL TG++++ +SS  K   ++ S   + Q      +S+  P      +S+P
Sbjct:   15 VFCTADEASLCGGCDHQVHHANKLASKHLRFSLLYPSSSNTSSPLCDICQDKKALLFCQQDRAILCKDCDSSIHAANEHTKKHDRFLLTGVKLSATSSVYKPTSKSSSSSSSNQDFSVPGSSISNPPPLKKPLSAP 150          
BLAST of FC924871 vs. ExPASy Swiss-Prot
Match: COL1_ARATH (Zinc finger protein CONSTANS-LIKE 1 OS=Arabidopsis thaliana GN=COL1 PE=1 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 2.977e-15
Identity = 52/163 (31.90%), Postives = 80/163 (49.08%), Query Frame = 3
Query:    3 VICCADEAALCAKCDVEVHAANKLASKHQRLLLQCLSNKLPPCDICQEKAAFIFCVEDRALFCKDCDEPIHSPGSLSANHQR--FLATGIRVALSSSCSKDAERNISEPPNQ-----------QASQTSVKMPTQ-QSSSISSPWAV-DDFLQFSDFESSGKK 446
            V C AD A LC+ CD +VHAAN+LAS+H+R+ +         C  C+   A  FC  D A  C  CD  IHS   L+  HQR   L        S++ +   E  +++P N+           +A   S  +P   ++S  ++ +++ D+FL   D+ SS K+
Sbjct:   22 VYCRADSAYLCSSCDAQVHAANRLASRHERVRV---------CQSCERAPAAFFCKADAASLCTTCDSEIHSANPLARRHQRVPILPISEYSYSSTATNHSCETTVTDPENRLVLGQEEEDEDEAEAASWLLPNSGKNSGNNNGFSIGDEFLNLVDYSSSDKQ 175          
BLAST of FC924871 vs. ExPASy Swiss-Prot
Match: COL3_ARATH (Zinc finger protein CONSTANS-LIKE 3 OS=Arabidopsis thaliana GN=COL3 PE=1 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 6.208e-13
Identity = 38/103 (36.89%), Postives = 53/103 (51.46%), Query Frame = 3
Query:    3 VICCADEAALCAKCDVEVHAANKLASKHQRLLLQCLSNKLPPCDICQEKAAFIFCVEDRALFCKDCDEPIHSPGSLSANHQRFLATGIRVALSSSCSKDAERN 311
            + C AD A LC  CD ++H ANKLAS+H+R+ L         C++C++  A + C  D A  C  CD  IHS   LS  H+R   T    A+  + S  +  N
Sbjct:   18 LFCRADAAFLCGDCDGKIHTANKLASRHERVWL---------CEVCEQAPAHVTCKADAAALCVTCDRDIHSANPLSRRHERVPITPFYDAVGPAKSASSSVN 111          
BLAST of FC924871 vs. ExPASy Swiss-Prot
Match: COL4_ARATH (Zinc finger protein CONSTANS-LIKE 4 OS=Arabidopsis thaliana GN=COL4 PE=2 SV=2)

HSP 1 Score: 73.559 bits (179), Expect = 1.383e-12
Identity = 48/157 (30.57%), Postives = 68/157 (43.31%), Query Frame = 3
Query:    9 CCADEAALCAKCDVEVHAANKLASKHQRLLLQCLSNKLPPCDICQEKAAFIFCVEDRALFCKDCDEPIHSPGSLSANHQRFLATGIRVALSSSCSKDAERNISEPPNQQASQTSVKMPTQQSSSISSPWAVDDFLQFSDFESSGKKEQLEFGELEWI 479
            C  D A LC  CD +VHAANKLAS+H R+ +         C++C++  A + C  D A  C  CD  IHS   L+  H+R   T    ++SS  S                 T+V               +DD   FSD + +G +E+ E     W+
Sbjct:   18 CRPDAAFLCLSCDSKVHAANKLASRHARVWM---------CEVCEQAPAHVTCKADAAALCVTCDRDIHSANPLARRHERVPVTPFYDSVSSDGS--------------VKHTAVNF-------------LDD-CYFSDIDGNGSREEEEEEAASWL 137          
BLAST of FC924871 vs. ExPASy Swiss-Prot
Match: COL2_ARATH (Zinc finger protein CONSTANS-LIKE 2 OS=Arabidopsis thaliana GN=COL2 PE=1 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 2.608e-11
Identity = 39/100 (39.00%), Postives = 49/100 (49.00%), Query Frame = 3
Query:    3 VICCADEAALCAKCDVEVHAANKLASKHQRLLLQCLSNKLPPCDICQEKAAFIFCVEDRALFCKDCDEPIHSPGSLSANHQRFLATGIRVALSSSCSKDA 302
            V C AD A LC  CD  VHAAN++AS+H+R+ +         C  C+   A   C  D A  C  CD  IHS   L+  HQR     I    ++SCS  A
Sbjct:   26 VYCEADSAYLCTTCDARVHAANRVASRHERVRV---------CQSCESAPAAFLCKADAASLCTACDAEIHSANPLARRHQR---VPILPLSANSCSSMA 113          
BLAST of FC924871 vs. ExPASy Swiss-Prot
Match: CONS_ARATH (Zinc finger protein CONSTANS OS=Arabidopsis thaliana GN=CO PE=1 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 3.406e-11
Identity = 32/82 (39.02%), Postives = 44/82 (53.66%), Query Frame = 3
Query:    3 VICCADEAALCAKCDVEVHAANKLASKHQRLLLQCLSNKLPPCDICQEKAAFIFCVEDRALFCKDCDEPIHSPGSLSANHQR 248
            V C AD A LC  CD +VH+AN++AS+H+R+ +         C+ C+   A   C  D A  C  CD  +HS   L+  HQR
Sbjct:   30 VYCHADSAYLCMSCDAQVHSANRVASRHKRVRV---------CESCERAPAAFLCEADDASLCTACDSEVHSANPLARRHQR 102          
The following BLAST results are available for this feature:
BLAST of FC924871 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 9
Match NameE-valueIdentityDescription
STH_ARATH1.149e-7563.88Salt tolerance-like protein OS=Arabidopsis thalian... [more]
STO_ARATH2.560e-7562.98Salt tolerance protein OS=Arabidopsis thaliana GN=... [more]
STHY_ARATH2.596e-2736.36Probable salt tolerance-like protein At1g78600 OS=... [more]
STHX_ARATH9.234e-2544.12Probable salt tolerance-like protein At1g75540 OS=... [more]
COL1_ARATH2.977e-1531.90Zinc finger protein CONSTANS-LIKE 1 OS=Arabidopsis... [more]
COL3_ARATH6.208e-1336.89Zinc finger protein CONSTANS-LIKE 3 OS=Arabidopsis... [more]
COL4_ARATH1.383e-1230.57Zinc finger protein CONSTANS-LIKE 4 OS=Arabidopsis... [more]
COL2_ARATH2.608e-1139.00Zinc finger protein CONSTANS-LIKE 2 OS=Arabidopsis... [more]
CONS_ARATH3.406e-1139.02Zinc finger protein CONSTANS OS=Arabidopsis thalia... [more]
back to top
Libraries
Library NameType
TFcdna_library
Properties
Property NameValue
Genbank descriptionKN0AAP6YM02FM1 TF Citrus clementina cDNA clone KN0AAP6YM02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC924871 ID=FC924871|Name=FC924871|organism=Citrus clementina|type=EST|length=774bp
CAGTGATTTGCTGTGCGGATGAGGCTGCTTTGTGTGCTAAATGTGATGTT
GAAGTTCACGCAGCAAACAAGCTAGCTAGCAAGCACCAGAGGCTTCTTCT
TCAGTGTCTTTCCAATAAGCTTCCTCCATGTGATATATGCCAAGAAAAGG
CAGCTTTCATTTTCTGTGTTGAAGACAGAGCACTCTTCTGTAAGGACTGT
GATGAACCTATCCATTCACCTGGTAGTCTTTCTGCTAACCATCAGAGGTT
TTTGGCCACTGGAATCCGAGTAGCCTTAAGCTCTAGTTGTTCCAAAGATG
CTGAAAGGAATATATCTGAGCCACCAAATCAGCAAGCATCACAAACTTCA
GTAAAAATGCCTACACAGCAATCTTCGAGCATCTCATCTCCTTGGGCCGT
GGACGACTTCTTACAATTCTCAGATTTTGAATCCTCTGGAAAGAAAGAGC
AACTCGAGTTTGGAGAGCTTGAATGGATAGCAGACATGGGAATATTCAAC
GACCAACTTCCTCAGGAGGCTCTAGCAGCTGCTGAAGTACCTCAACTCCC
GGTGTCGCAGCCCAACAACTTAATATCATCATACAGGCCCACAAAATTCA
ATATGCCATACAAGAAGCCAAGGATTGAGATCCCAGATGATGATGATGAG
CATTTCACTGTCCCAGATCTTGGTTAAACATAAAGAAATAATATCTACAG
TCCTTCATAGGTTGATGAACTACCCATACCTTCCTATGTACCACTACCTA
TAAATATGTATTTAGACCCTTGTT
back to top