FC924874

Overview
NameFC924874
Unique NameFC924874
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length608
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15122 contig Ccv1_Contig15122:26..634. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC924874 vs. ExPASy Swiss-Prot
Match: MDAR_SOLLC (Monodehydroascorbate reductase OS=Solanum lycopersicum GN=AFRR PE=1 SV=1)

HSP 1 Score: 290.041 bits (741), Expect = 6.127e-78
Identity = 148/186 (79.57%), Postives = 160/186 (86.02%), Query Frame = 1
Query:   49 MAEKSFKYVILGGGVSAGYAAREFAKQGVKPGELAIISKEAVAPYERPALSKAYLFPEGTARLPGFHVCVGSGGERLLPEWYKEKGIELILSTEIVRADIASKTLLSATGLIFKYQILVIATGSTVLRLTDFGVEGADAKNIFYLREIDDADKLVEXXXXXXXXXXXXXXXXYIGPELSAALKINN 606
            MAEKSFKYVI+GGGVSAGYAAREFAKQGVKPGELAIISKEAVAPYERPALSKAYLFPEG ARLPGFHVCVGSGGER LPEWY EKGI LILSTEIV+AD+ASKTL+SA G  FKYQ LVIATG+TVL+L+DFGV+GAD+KNIFYLREIDDAD+LVE                YIG ELSA L++NN
Sbjct:    1 MAEKSFKYVIVGGGVSAGYAAREFAKQGVKPGELAIISKEAVAPYERPALSKAYLFPEGAARLPGFHVCVGSGGERQLPEWYAEKGISLILSTEIVKADLASKTLVSAAGESFKYQTLVIATGTTVLKLSDFGVQGADSKNIFYLREIDDADQLVEALKAKKNGKAVVVGGGYIGLELSAVLRLNN 186          
BLAST of FC924874 vs. ExPASy Swiss-Prot
Match: MDAR3_ARATH (Probable monodehydroascorbate reductase, cytoplasmic isoform 3 OS=Arabidopsis thaliana GN=At3g52880 PE=1 SV=1)

HSP 1 Score: 283.878 bits (725), Expect = 4.391e-76
Identity = 143/186 (76.88%), Postives = 160/186 (86.02%), Query Frame = 1
Query:   49 MAEKSFKYVILGGGVSAGYAAREFAKQGVKPGELAIISKEAVAPYERPALSKAYLFPEGTARLPGFHVCVGSGGERLLPEWYKEKGIELILSTEIVRADIASKTLLSATGLIFKYQILVIATGSTVLRLTDFGVEGADAKNIFYLREIDDADKLVEXXXXXXXXXXXXXXXXYIGPELSAALKINN 606
            MAEKSFKY+ILGGGVSAGYAA+EFA QGV+PGELA+ISKEAVAPYERPALSK YLFPEG ARLPGFH CVGSGGE+LLPE YK+KGIELILSTEIV+AD+++K+L+SATG +FKYQ L+IATGSTVLRLTDFGV+GAD+KNI YLREIDDADKLVE                YIG ELSA L+INN
Sbjct:    1 MAEKSFKYIILGGGVSAGYAAKEFANQGVQPGELAVISKEAVAPYERPALSKGYLFPEGAARLPGFHCCVGSGGEKLLPESYKQKGIELILSTEIVKADLSAKSLVSATGDVFKYQTLIIATGSTVLRLTDFGVKGADSKNILYLREIDDADKLVEAIKAKKGGKAVVVGGGYIGLELSAVLRINN 186          
BLAST of FC924874 vs. ExPASy Swiss-Prot
Match: MDARS_CUCSA (Monodehydroascorbate reductase, seedling isozyme OS=Cucumis sativus PE=2 SV=1)

HSP 1 Score: 277.715 bits (709), Expect = 3.147e-74
Identity = 140/186 (75.27%), Postives = 156/186 (83.87%), Query Frame = 1
Query:   49 MAEKSFKYVILGGGVSAGYAAREFAKQGVKPGELAIISKEAVAPYERPALSKAYLFPEGTARLPGFHVCVGSGGERLLPEWYKEKGIELILSTEIVRADIASKTLLSATGLIFKYQILVIATGSTVLRLTDFGVEGADAKNIFYLREIDDADKLVEXXXXXXXXXXXXXXXXYIGPELSAALKINN 606
            MA+++FKYVILGGGV+AGYAAREF KQG+ PGELAIISKEAVAPYERPALSKAYLFPE  ARLPGFHVCVGSGGERLLP+WYKEKGIELILSTEIV AD+ +K L SA G I+ YQ L+IATGSTV++L+DFGV+GADAKNIFYLREIDDAD+LVE                YIG EL AAL+INN
Sbjct:    1 MADETFKYVILGGGVAAGYAAREFVKQGLNPGELAIISKEAVAPYERPALSKAYLFPESPARLPGFHVCVGSGGERLLPDWYKEKGIELILSTEIVEADLPAKRLRSAHGKIYNYQTLIIATGSTVIKLSDFGVQGADAKNIFYLREIDDADQLVEAIKAKENGKVVVVGGGYIGLELGAALRINN 186          
BLAST of FC924874 vs. ExPASy Swiss-Prot
Match: MDAR_PEA (Monodehydroascorbate reductase OS=Pisum sativum PE=1 SV=1)

HSP 1 Score: 264.233 bits (674), Expect = 3.600e-70
Identity = 136/182 (74.73%), Postives = 146/182 (80.22%), Query Frame = 1
Query:   61 SFKYVILGGGVSAGYAAREFAKQGVKPGELAIISKEAVAPYERPALSKAYLFPEGTARLPGFHVCVGSGGERLLPEWYKEKGIELILSTEIVRADIASKTLLSATGLIFKYQILVIATGSTVLRLTDFGVEGADAKNIFYLREIDDADKLVEXXXXXXXXXXXXXXXXYIGPELSAALKINN 606
            SFKY+I+GGGVSAGYAAREF KQGV PGELAIISKEAVAPYERPALSKAYLFPE  ARLPGFH CVGSGGERLLPEWY EKGI+L LSTEIV AD+A+K L SA G  F YQ LVIATGS V+RLTDFGV GA+AKNIFYLRE+DDADKL E                YIG ELSA LK+N+
Sbjct:    4 SFKYIIIGGGVSAGYAAREFVKQGVHPGELAIISKEAVAPYERPALSKAYLFPESPARLPGFHTCVGSGGERLLPEWYSEKGIQLYLSTEIVSADLAAKFLKSANGEHFDYQTLVIATGSAVIRLTDFGVIGANAKNIFYLREVDDADKLYEAIKRKKNAKRVVVGGGYIGLELSAVLKLND 185          
BLAST of FC924874 vs. ExPASy Swiss-Prot
Match: MDAR4_ARATH (Probable monodehydroascorbate reductase, cytoplasmic isoform 4 OS=Arabidopsis thaliana GN=At5g03630 PE=1 SV=1)

HSP 1 Score: 241.121 bits (614), Expect = 3.264e-63
Identity = 123/184 (66.85%), Postives = 140/184 (76.09%), Query Frame = 1
Query:   55 EKSFKYVILGGGVSAGYAAREFAKQGVKPGELAIISKEAVAPYERPALSKAYLFPEGTARLPGFHVCVGSGGERLLPEWYKEKGIELILSTEIVRADIASKTLLSATGLIFKYQILVIATGSTVLRLTDFGVEGADAKNIFYLREIDDADKLVEXXXXXXXXXXXXXXXXYIGPELSAALKINN 606
            EKSFKYVI+GGGV+AGYAAREF  QGVKPGELAIIS+E V PYERPALSK Y+  E  A LP F+V  G GGER  P+WYKEKGIELIL TEIV+AD+A+KTL+S TG +FKYQ L+ ATGS+V+RL+DFGV GADAKNIFYLRE++DAD L                  YIG EL AALK NN
Sbjct:    4 EKSFKYVIVGGGVAAGYAAREFFNQGVKPGELAIISREQVPPYERPALSKGYIHLENKATLPNFYVAAGIGGERQFPQWYKEKGIELILGTEIVKADLAAKTLVSGTGQVFKYQTLLAATGSSVIRLSDFGVPGADAKNIFYLRELEDADYLAYAMETKEKGKAVVVGGGYIGLELGAALKANN 187          
BLAST of FC924874 vs. ExPASy Swiss-Prot
Match: MDAR1_ARATH (Probable monodehydroascorbate reductase, cytoplasmic isoform 1 OS=Arabidopsis thaliana GN=At3g09940 PE=2 SV=1)

HSP 1 Score: 204.912 bits (520), Expect = 2.592e-52
Identity = 104/185 (56.22%), Postives = 135/185 (72.97%), Query Frame = 1
Query:   55 EKSFKYVILGGGVSAGYAAREFAKQGVKPGELAIISKEAVAPYERPALSKAYLFPEGTARLPGFHVCVGSGGERLLPEWYKEKGIELILSTEIVRADIASKTLLSATGLIFKYQILVIATGSTVLRLTDFGVEGADAKNIFYLREIDDADKL-VEXXXXXXXXXXXXXXXXYIGPELSAALKINN 606
            EKS+KYVI+GGGV+ GYAAREF+ QG+KPGELAIISKE V P+ERP L+K Y+  E    L   +VC G+G  +  P WYKEKGI+LI+ TEIV+AD+ASKTL+S  G I+KYQ L+IATGST +RL++ GV+ AD KNIFYLREI+D+D+L +                 ++G E+S+AL+ NN
Sbjct:    4 EKSYKYVIIGGGVAGGYAAREFSNQGLKPGELAIISKEPVPPFERPELTKVYIDLEVNPTLANIYVCAGTGEAKQYPNWYKEKGIDLIVGTEIVKADLASKTLVSDDGKIYKYQTLLIATGSTNIRLSEIGVQEADVKNIFYLREIEDSDELALAMELYVQRGKAVIIGGGFLGLEISSALRANN 188          
BLAST of FC924874 vs. ExPASy Swiss-Prot
Match: MDAR2_ARATH (Probable monodehydroascorbate reductase, cytoplasmic isoform 2 OS=Arabidopsis thaliana GN=At3g27820 PE=2 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 3.743e-51
Identity = 98/182 (53.85%), Postives = 127/182 (69.78%), Query Frame = 1
Query:   58 KSFKYVILGGGVSAGYAAREFAKQGVKPGELAIISKEAVAPYERPALSKAYLFPEGTARLPGFHVCVGSGGERLLPEWYKEKGIELILSTEIVRADIASKTLLSATGLIFKYQILVIATGSTVLRLTDFGVEGADAKNIFYLREIDDADKLVEXXXXXXXXXXXXXXXXYIGPELSAALKIN 603
            ++F YVILGGGV+AGYAA EF ++GV  GEL IIS+E VAPYERPALSK +L PE  ARLP FH CVG+  E+L P+WYK+ GIEL+L T +   D+  KTLLS+TG    Y+ L+IATG+  L+L +FGVEG+DA+N+ YLR++ DA++L                  YIG E +A+L IN
Sbjct:    3 RAFVYVILGGGVAAGYAALEFTRRGVSDGELCIISEEPVAPYERPALSKGFLLPEAPARLPSFHTCVGANDEKLTPKWYKDHGIELVLGTRVKSVDVRRKTLLSSTGETISYKFLIIATGARALKLEEFGVEGSDAENVCYLRDLADANRLATVIQSSSNGNAVVIGGGYIGMECAASLVIN 184          
BLAST of FC924874 vs. ExPASy Swiss-Prot
Match: MDARP_ARATH (Monodehydroascorbate reductase, chloroplastic OS=Arabidopsis thaliana GN=At1g63940 PE=2 SV=3)

HSP 1 Score: 160.229 bits (404), Expect = 7.322e-39
Identity = 88/184 (47.83%), Postives = 112/184 (60.87%), Query Frame = 1
Query:   46 SMAEKSFKYVILGGGVSAGYAAREFAKQGVKPGELAIISKEAVAPYERPALSKAYLFP--EGTARLPGFHVCVGSGGERLLPEWYKEKGIELILSTEIVRADIASKTLLSATGLIFKYQILVIATGSTVLRLTDFGVEGADAKNIFYLREIDDADKLVEXXXXXXXXXXXXXXXXYIGPELSAA 591
            S A ++ ++VI+GGG +AGYAAR F + G+  G L I++KEA APYERPAL+KAYLFP  +  ARLPGFH CVG GGER  P+WYKEKGIE+I    +  AD   +TL +  G   KY  L+IATG T  R  D    G     + Y+RE+ DAD L+                 YIG E++AA
Sbjct:   55 SFANENREFVIVGGGNAAGYAARTFVENGMADGRLCIVTKEAYAPYERPALTKAYLFPPEKKPARLPGFHTCVGGGGERQTPDWYKEKGIEVIYEDPVAGADFEKQTLTTDAGKQLKYGSLIIATGCTASRFPD--KIGGHLPGVHYIREVADADSLI--ASLGKAKKIVIVGGGYIGMEVAAA 234          
BLAST of FC924874 vs. ExPASy Swiss-Prot
Match: RURE_PSEOL (Rubredoxin-NAD(+) reductase OS=Pseudomonas oleovorans GN=alkT PE=3 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 3.659e-14
Identity = 52/147 (35.37%), Postives = 78/147 (53.06%), Query Frame = 1
Query:   73 VILGGGVSAGYAAREFAKQGVKPGELAIISKEAVAPYERPALSKAYLFPEGTARLPGFHVCVGSGGERLLPE-WYKEKGIELILSTEIVRADIASKTLLSATGLIFKYQILVIATGSTVLRLTDFGVEGADAKNIFYLREIDDADKL 510
            V++G G +   AA    + G K GE+ I S+E+VAPY+RP LSKA+L  E           +      L PE +Y    I + L+T IV  D+  K + S  G  + Y+ L++AT ++  RLT    EG++   + YLR ++DA  L
Sbjct:    4 VVVGAGTAGVNAAFWLRQYGYK-GEIRIFSRESVAPYQRPPLSKAFLTSE-----------IAESAVPLKPEGFYTNNNITISLNTPIVSIDVGRKIVSSKDGKEYAYEKLILATPASARRLT---CEGSELSGVCYLRSMEDAKNL 135          
The following BLAST results are available for this feature:
BLAST of FC924874 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 9
Match NameE-valueIdentityDescription
MDAR_SOLLC6.127e-7879.57Monodehydroascorbate reductase OS=Solanum lycopers... [more]
MDAR3_ARATH4.391e-7676.88Probable monodehydroascorbate reductase, cytoplasm... [more]
MDARS_CUCSA3.147e-7475.27Monodehydroascorbate reductase, seedling isozyme O... [more]
MDAR_PEA3.600e-7074.73Monodehydroascorbate reductase OS=Pisum sativum PE... [more]
MDAR4_ARATH3.264e-6366.85Probable monodehydroascorbate reductase, cytoplasm... [more]
MDAR1_ARATH2.592e-5256.22Probable monodehydroascorbate reductase, cytoplasm... [more]
MDAR2_ARATH3.743e-5153.85Probable monodehydroascorbate reductase, cytoplasm... [more]
MDARP_ARATH7.322e-3947.83Monodehydroascorbate reductase, chloroplastic OS=A... [more]
RURE_PSEOL3.659e-1435.37Rubredoxin-NAD(+) reductase OS=Pseudomonas oleovor... [more]
back to top
Libraries
Library NameType
TFcdna_library
Properties
Property NameValue
Genbank descriptionKN0AAP6YM05FM1 TF Citrus clementina cDNA clone KN0AAP6YM05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC924874 ID=FC924874|Name=FC924874|organism=Citrus clementina|type=EST|length=608bp
TAAATAGAAACCGAAATCGTTGAGCATTTAACTTTTTTCGATCGATCAAT
GGCGGAGAAGAGCTTCAAGTACGTGATCCTCGGTGGCGGTGTCTCTGCTG
GATATGCAGCTAGGGAGTTTGCTAAGCAGGGTGTTAAGCCAGGCGAGCTG
GCAATTATCTCCAAAGAAGCGGTTGCTCCGTATGAGCGTCCAGCACTTAG
CAAGGCATATCTTTTCCCTGAGGGAACTGCTAGACTTCCCGGTTTCCATG
TCTGTGTTGGAAGTGGTGGAGAGAGACTGCTTCCTGAGTGGTACAAAGAG
AAAGGAATCGAATTGATCCTCAGCACGGAAATAGTCAGAGCAGATATTGC
TTCCAAGACTCTCCTTAGTGCAACTGGGCTTATCTTTAAGTACCAGATTT
TAGTAATTGCAACTGGTTCTACAGTTTTACGGTTGACTGATTTTGGTGTT
GAAGGTGCTGATGCCAAAAATATCTTCTACTTAAGAGAAATTGATGATGC
TGATAAGCTGGTTGAAGCAATAAAAGCAAAGAAGAATGGGAAGGCAGTGG
TTGTTGGAGGAGGATACATTGGTCCTGAGCTTAGTGCAGCTTTAAAAATA
AATAATAT
back to top