FC924882

Overview
NameFC924882
Unique NameFC924882
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length570
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig3641 contig Ccv1_Contig3641:1..570. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC924882 vs. ExPASy Swiss-Prot
Match: MOCOS_SOLLC (Molybdenum cofactor sulfurase OS=Solanum lycopersicum GN=FLACCA PE=2 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 2.908e-31
Identity = 67/122 (54.92%), Postives = 84/122 (68.85%), Query Frame = 1
Query:    1 LTQNIVPEMCLISTYIDLNQEILVVKSPRCRDELPINLKPDSYNGGIDEIDLYGQRYEVLGYADEINLWFSKAIGRPCSLLQCFSPTFRVCLNKRGDTVMCRDLESRLNFTNEAQFLLVSEE 366
            LTQ  VPEMC IST IDLN   L V+SPRC+++L I LK  S     DE+D+   RYEV  Y +E+++WFS+AI RPC+LL+        C+NK G   MCRD+ +RLNF NEAQFLL+SEE
Sbjct:  565 LTQKKVPEMCYISTLIDLNLGKLFVESPRCKEKLQIELKSSSLVTERDEMDIQNHRYEVTSYNNEVDIWFSRAIDRPCTLLRNSDSQSHSCINKNGSPGMCRDVGARLNFVNEAQFLLISEE 686          
BLAST of FC924882 vs. ExPASy Swiss-Prot
Match: MOCOS_ARATH (Molybdenum cofactor sulfurase OS=Arabidopsis thaliana GN=ABA3 PE=1 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 6.704e-28
Identity = 64/122 (52.46%), Postives = 78/122 (63.93%), Query Frame = 1
Query:    1 LTQNIVPEMCLISTYIDLNQEILVVKSPRCRDELPINLKPDSYNGGIDEIDLYGQRYEVLGYADEINLWFSKAIGRPCSLLQCFSPTFRVCLNKRGDTVMCRDLESRLNFTNEAQFLLVSEE 366
            LTQ  VPEM LI T+IDL + +L V+S RC D+L I +K DSYN   DE D +    E       IN WF+ AIGR C LL+  S T + CLN+     +CRDLES +NF NEAQFLL+SEE
Sbjct:  573 LTQKKVPEMSLIKTFIDLEEGLLSVESSRCEDKLHIRIKSDSYNPRNDEFDSHANILENRNEETRINRWFTNAIGRQCKLLRYSSSTSKDCLNRNKSPGLCRDLESNINFANEAQFLLISEE 694          
BLAST of FC924882 vs. ExPASy Swiss-Prot
Match: MOCOS_ORYSJ (Molybdenum cofactor sulfurase OS=Oryza sativa subsp. japonica GN=MCSU3 PE=2 SV=2)

HSP 1 Score: 112.079 bits (279), Expect = 2.019e-24
Identity = 59/122 (48.36%), Postives = 79/122 (64.75%), Query Frame = 1
Query:    1 LTQNIVPEMCLISTYIDLNQEILVVKSPRCRDELPINLKPDSYNGGIDEIDLYGQRYEVLGYADEINLWFSKAIGRPCSLLQCFSPTFRVCLNKRGDTVMCRDLESRLNFTNEAQFLLVSEE 366
            LTQ  VPE+  I T IDL    L ++SP  RD+L ++L  +S     +E+D++GQRYEV  Y D +N WFS+AIGRPC+L++C S  +R C         CRD +S+LNF NE Q LL+SEE
Sbjct:  574 LTQKKVPELGSIRTLIDLELGKLFIESPTRRDKLQLSLL-ESLADLSEEVDVFGQRYEVQSYDDRVNTWFSEAIGRPCTLVRCSSSKYRSCTYTGLRDRPCRDTQSKLNFVNEGQLLLISEE 694          
The following BLAST results are available for this feature:
BLAST of FC924882 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
MOCOS_SOLLC2.908e-3154.92Molybdenum cofactor sulfurase OS=Solanum lycopersi... [more]
MOCOS_ARATH6.704e-2852.46Molybdenum cofactor sulfurase OS=Arabidopsis thali... [more]
MOCOS_ORYSJ2.019e-2448.36Molybdenum cofactor sulfurase OS=Oryza sativa subs... [more]
back to top
Libraries
Library NameType
TFcdna_library
Properties
Property NameValue
Genbank descriptionKN0AAP6YM13FM1 TF Citrus clementina cDNA clone KN0AAP6YM13, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC924882 ID=FC924882|Name=FC924882|organism=Citrus clementina|type=EST|length=570bp
CTTACACAGAACATTGTTCCTGAAATGTGCCTCATTAGTACTTATATTGA
CCTCAATCAAGAAATATTGGTTGTAAAGTCGCCGCGCTGCAGAGATGAAT
TACCGATCAACCTAAAACCAGATTCATATAATGGTGGGATAGATGAAATT
GATCTTTATGGCCAGAGGTACGAAGTCCTTGGTTATGCAGATGAAATCAA
CTTATGGTTTAGCAAAGCCATTGGTCGACCTTGCTCTTTACTCCAATGTT
TTAGCCCTACATTTCGAGTTTGCTTGAACAAGAGGGGAGATACAGTTATG
TGCAGAGATTTGGAGAGCAGATTGAACTTTACTAATGAAGCTCAATTCTT
ATTGGTATCCGAGGAAAGCGTATCAGATCTCAACAGCAAACTAAGTTCTA
GTATGTTCACGTCCTACTTTCCTGCCATATAAGAACTTCTTGCTTTTGTT
AATATAGCAGTTTACAGTTAGTTATGACTAATTTTTATTATCGTTTTGGG
GATAAACATTAAATAAGTAAGCAGATAAAGGGAATTACTTAGGTGATTTC
CCTGTTCTTGCCGTGAATAG
back to top