FC924883

Overview
NameFC924883
Unique NameFC924883
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length644
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig1790 contig Ccv1_Contig1790:10..653. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC924883 vs. ExPASy Swiss-Prot
Match: ODO1_XENLA (2-oxoglutarate dehydrogenase, mitochondrial OS=Xenopus laevis GN=ogdh PE=2 SV=1)

HSP 1 Score: 228.024 bits (580), Expect = 3.191e-59
Identity = 114/213 (53.52%), Postives = 150/213 (70.42%), Query Frame = 1
Query:    1 GLVVLLPHGYDGQGPEHSSARLERFLQMSDDNPFVIPEMDPTLRK-QIQECNWQIVNVTTPANYFHVLRRQIHRGFRKPLIVMSPKNLLRHKDCKSNLSEFDDVQGHPGFDKQGTRFKRLIKDQNGHSDLEEGIRRLVLCSGKVYYELDEERKKRSAS-DVAICRVEQLCPFPYDLVQRELKRYPNAEIVWCQEEPMNMGAYTYISPRLATAM 633
            G+V+LLPHG +G GPEHSSAR ERFLQM +D+P V P+        Q+ +CNW +VN +TPAN+FHV+RRQI   FRKPLIV +PK+LLRH + +S+   FDD+          T F+R+I +    S   EG++RL+ C+GKVYYEL +ER  R    DVAI RVEQL PFP+DLV++E+++YPNA++VWCQEE  N G Y Y+ PRL T +
Sbjct:  773 GIVLLLPHGMEGMGPEHSSARPERFLQMCNDDPDVWPKASEDFAVGQLYDCNWIVVNCSTPANFFHVIRRQILLPFRKPLIVFTPKSLLRHPEARSS---FDDML-------PSTHFQRIIPEAGPASQNPEGVKRLIFCTGKVYYELTKERSGRDMEGDVAIARVEQLSPFPFDLVEKEVQKYPNADLVWCQEEHKNQGYYDYVKPRLRTTI 975          
BLAST of FC924883 vs. ExPASy Swiss-Prot
Match: ODO1_MACFA (2-oxoglutarate dehydrogenase, mitochondrial OS=Macaca fascicularis GN=OGDH PE=2 SV=1)

HSP 1 Score: 221.476 bits (563), Expect = 2.987e-57
Identity = 107/214 (50.00%), Postives = 145/214 (67.76%), Query Frame = 1
Query:    1 GLVVLLPHGYDGQGPEHSSARLERFLQMSDDNPFVIPEMDPTLR--KQIQECNWQIVNVTTPANYFHVLRRQIHRGFRKPLIVMSPKNLLRHKDCKSNLSEFDDVQGHPGFDKQGTRFKRLIKDQNGHSDLEEGIRRLVLCSGKVYYELDEERKKRS-ASDVAICRVEQLCPFPYDLVQRELKRYPNAEIVWCQEEPMNMGAYTYISPRLATAM 633
            G+V+LLPHG +G GPEHSSAR ERFLQM +D+P V+P++        Q+ +CNW +VN +TP N+FHVLRRQI   FRKPLI+ +PK+LLRH + +S+  E             GT F+R+I +    +   E ++RL+ C+GKVYY+L  ERK R     VAI R+EQL PFP+DL+ +E+++YPNAE+ WCQEE  N G Y Y+ PRL T +
Sbjct:  774 GIVLLLPHGMEGMGPEHSSARPERFLQMCNDDPDVLPDLKEANFDINQLHDCNWVVVNCSTPGNFFHVLRRQILLPFRKPLIIFTPKSLLRHPEARSSFDEM----------LPGTHFQRVIPEDGPAAQNPENVKRLLFCTGKVYYDLTRERKARDMVGQVAITRIEQLSPFPFDLLLKEVQKYPNAELAWCQEEHKNQGYYDYVKPRLRTTI 977          
BLAST of FC924883 vs. ExPASy Swiss-Prot
Match: ODO1_HUMAN (2-oxoglutarate dehydrogenase, mitochondrial OS=Homo sapiens GN=OGDH PE=1 SV=3)

HSP 1 Score: 221.09 bits (562), Expect = 3.901e-57
Identity = 107/214 (50.00%), Postives = 145/214 (67.76%), Query Frame = 1
Query:    1 GLVVLLPHGYDGQGPEHSSARLERFLQMSDDNPFVIPEMDPTLR--KQIQECNWQIVNVTTPANYFHVLRRQIHRGFRKPLIVMSPKNLLRHKDCKSNLSEFDDVQGHPGFDKQGTRFKRLIKDQNGHSDLEEGIRRLVLCSGKVYYELDEERKKRS-ASDVAICRVEQLCPFPYDLVQRELKRYPNAEIVWCQEEPMNMGAYTYISPRLATAM 633
            G+V+LLPHG +G GPEHSSAR ERFLQM +D+P V+P++        Q+ +CNW +VN +TP N+FHVLRRQI   FRKPLI+ +PK+LLRH + +S+  E             GT F+R+I +    +   E ++RL+ C+GKVYY+L  ERK R     VAI R+EQL PFP+DL+ +E+++YPNAE+ WCQEE  N G Y Y+ PRL T +
Sbjct:  774 GIVLLLPHGMEGMGPEHSSARPERFLQMCNDDPDVLPDLKEANFDINQLYDCNWVVVNCSTPGNFFHVLRRQILLPFRKPLIIFTPKSLLRHPEARSSFDEM----------LPGTHFQRVIPEDGPAAQNPENVKRLLFCTGKVYYDLTRERKARDMVGQVAITRIEQLSPFPFDLLLKEVQKYPNAELAWCQEEHKNQGYYDYVKPRLRTTI 977          
BLAST of FC924883 vs. ExPASy Swiss-Prot
Match: ODO1_PONAB (2-oxoglutarate dehydrogenase, mitochondrial OS=Pongo abelii GN=OGDH PE=2 SV=1)

HSP 1 Score: 219.164 bits (557), Expect = 1.483e-56
Identity = 106/214 (49.53%), Postives = 145/214 (67.76%), Query Frame = 1
Query:    1 GLVVLLPHGYDGQGPEHSSARLERFLQMSDDNPFVIPEMDPTLR--KQIQECNWQIVNVTTPANYFHVLRRQIHRGFRKPLIVMSPKNLLRHKDCKSNLSEFDDVQGHPGFDKQGTRFKRLIKDQNGHSDLEEGIRRLVLCSGKVYYELDEERKKRS-ASDVAICRVEQLCPFPYDLVQRELKRYPNAEIVWCQEEPMNMGAYTYISPRLATAM 633
            G+V+LLPHG +G GPEHSSAR ERFLQM +D+P V+P++        Q+ +CNW +VN +TP N+FHVLRRQI   FRKPLI+ +PK+LLRH + +S+  E             GT F+R+I +    +   E ++RL+ C+GKVYY+L  ERK R     VAI R+EQL PFP+DL+ +E+++YP+AE+ WCQEE  N G Y Y+ PRL T +
Sbjct:  774 GIVLLLPHGMEGMGPEHSSARPERFLQMCNDDPDVLPDLKEANFDINQLYDCNWVVVNCSTPGNFFHVLRRQILLPFRKPLIIFTPKSLLRHPEARSSFDEM----------LPGTHFQRVIPEDGPAAQNPENVKRLLFCTGKVYYDLTRERKARDMVGQVAITRIEQLSPFPFDLLLKEVQKYPSAELAWCQEEHKNQGYYDYVKPRLRTTI 977          
BLAST of FC924883 vs. ExPASy Swiss-Prot
Match: ODO1_RAT (2-oxoglutarate dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Ogdh PE=1 SV=1)

HSP 1 Score: 218.779 bits (556), Expect = 1.936e-56
Identity = 107/214 (50.00%), Postives = 145/214 (67.76%), Query Frame = 1
Query:    1 GLVVLLPHGYDGQGPEHSSARLERFLQMSDDNPFVIPEMDPTLR--KQIQECNWQIVNVTTPANYFHVLRRQIHRGFRKPLIVMSPKNLLRHKDCKSNLSEFDDVQGHPGFDKQGTRFKRLIKDQNGHSDLEEGIRRLVLCSGKVYYELDEERKKRS-ASDVAICRVEQLCPFPYDLVQRELKRYPNAEIVWCQEEPMNMGAYTYISPRLATAM 633
            G+V+LLPHG +G GPEHSSAR ERFLQM +D+P V+P +        Q+ +CNW +VN +TP N+FHVLRRQI   FRKPLIV +PK+LLRH + +++  E             GT F+R+I +    +   + ++RL+ C+GKVYY+L  ERK R  A +VAI R+EQL PFP+DL+ +E ++YPNAE+ WCQEE  N G Y Y+ PRL T +
Sbjct:  774 GIVLLLPHGMEGMGPEHSSARPERFLQMCNDDPDVLPNLQEENFDISQLYDCNWIVVNCSTPGNFFHVLRRQILLPFRKPLIVFTPKSLLRHPEARTSFDEM----------LPGTHFQRVIPEDGPAAQNPDKVKRLLFCTGKVYYDLTRERKARDMAEEVAITRIEQLSPFPFDLLLKEAQKYPNAELAWCQEEHKNQGYYDYVKPRLRTTI 977          
BLAST of FC924883 vs. ExPASy Swiss-Prot
Match: ODO1_BOVIN (2-oxoglutarate dehydrogenase, mitochondrial OS=Bos taurus GN=OGDH PE=2 SV=1)

HSP 1 Score: 218.009 bits (554), Expect = 3.303e-56
Identity = 106/214 (49.53%), Postives = 144/214 (67.29%), Query Frame = 1
Query:    1 GLVVLLPHGYDGQGPEHSSARLERFLQMSDDNPFVIPEMDPTLR--KQIQECNWQIVNVTTPANYFHVLRRQIHRGFRKPLIVMSPKNLLRHKDCKSNLSEFDDVQGHPGFDKQGTRFKRLIKDQNGHSDLEEGIRRLVLCSGKVYYELDEERKKRS-ASDVAICRVEQLCPFPYDLVQRELKRYPNAEIVWCQEEPMNMGAYTYISPRLATAM 633
            G+V+LLPHG +G GPEHSSAR ERFLQM +D+P V+P++        Q+ +CNW +VN +TP N+FHVLRRQI   FRKPLI+ +PK+LLRH + +SN  E             GT F+R+I +    +     ++RL+ C+GKVYY+L  ERK R     VAI R+EQL PFP+DL+ +E+++YP+AE+ WCQEE  N G Y Y+ PRL T +
Sbjct:  774 GIVLLLPHGMEGMGPEHSSARPERFLQMCNDDPDVLPDLKEANFDINQLYDCNWVVVNCSTPGNFFHVLRRQILLPFRKPLIIFTPKSLLRHPEARSNFDEM----------LPGTHFQRVIPEDGPAAQNPGNVKRLLFCTGKVYYDLTRERKARDMVEQVAITRIEQLSPFPFDLLLQEVQKYPSAELAWCQEEHKNQGYYDYVKPRLRTTI 977          
BLAST of FC924883 vs. ExPASy Swiss-Prot
Match: OGDHL_HUMAN (2-oxoglutarate dehydrogenase-like, mitochondrial OS=Homo sapiens GN=OGDHL PE=2 SV=3)

HSP 1 Score: 217.624 bits (553), Expect = 4.313e-56
Identity = 106/214 (49.53%), Postives = 144/214 (67.29%), Query Frame = 1
Query:    1 GLVVLLPHGYDGQGPEHSSARLERFLQMSDDNPFVIPEMDPTLR-KQIQECNWQIVNVTTPANYFHVLRRQIHRGFRKPLIVMSPKNLLRHKDCKSNLSEFDDVQGHPGFDKQGTRFKRLIKDQNGHSDLEEGIRRLVLCSGKVYYELDEERKKRSASD-VAICRVEQLCPFPYDLVQRELKRYPNAEIVWCQEEPMNMGAYTYISPRLATAMK 636
            G+V+LLPHG +G GPEHSSAR ERFLQMS+D+    P         Q+ +CNW +VN +TPANYFHVLRRQI   FRKPLI+ +PK+LLRH + KS+  +             GT F+R+I +    +   E ++RL+ C+GKVYY+L +ER  +   + VAI R+EQ+ PFP+DL+++E ++YP AE+ WCQEE  NMG Y YISPR  T ++
Sbjct:  761 GIVLLLPHGMEGMGPEHSSARPERFLQMSNDDSDAYPAFTKDFEVSQLYDCNWIVVNCSTPANYFHVLRRQILLPFRKPLIIFTPKSLLRHPEAKSSFDQM----------VSGTSFQRVIPEDGAAARAPEQVQRLIFCTGKVYYDLVKERSSQDLEEKVAITRLEQISPFPFDLIKQEAEKYPGAELAWCQEEHKNMGYYDYISPRFMTILR 964          
BLAST of FC924883 vs. ExPASy Swiss-Prot
Match: OGDHL_PONAB (2-oxoglutarate dehydrogenase-like, mitochondrial OS=Pongo abelii GN=OGDHL PE=2 SV=2)

HSP 1 Score: 216.853 bits (551), Expect = 7.358e-56
Identity = 106/214 (49.53%), Postives = 143/214 (66.82%), Query Frame = 1
Query:    1 GLVVLLPHGYDGQGPEHSSARLERFLQMSDDNPFVIPEMDPTLR-KQIQECNWQIVNVTTPANYFHVLRRQIHRGFRKPLIVMSPKNLLRHKDCKSNLSEFDDVQGHPGFDKQGTRFKRLIKDQNGHSDLEEGIRRLVLCSGKVYYELDEERKKRSASD-VAICRVEQLCPFPYDLVQRELKRYPNAEIVWCQEEPMNMGAYTYISPRLATAMK 636
            G+V+LLPHG +G GPEHSSAR ERFLQMS+D+    P         Q+ +CNW +VN +TPANYFHVLRRQI   FRKPLI+ +PK+LLRH + K +  +             GT F+R+I +    +   E +RRL+ C+GKVYY+L +ER  +   + VAI R+EQ+ PFP+DL+++E ++YP AE+ WCQEE  NMG Y YISPR  T ++
Sbjct:  761 GIVLLLPHGMEGMGPEHSSARPERFLQMSNDDSDAYPAFTKDFEVSQLYDCNWIVVNCSTPANYFHVLRRQILLPFRKPLIIFTPKSLLRHPEAKFSFDQM----------VSGTSFQRVIPEDGAAARAPEQVRRLIFCTGKVYYDLVKERSSQGLEEKVAITRLEQISPFPFDLIKQEAEKYPGAELAWCQEEHKNMGYYDYISPRFMTILR 964          
BLAST of FC924883 vs. ExPASy Swiss-Prot
Match: ODO1_MOUSE (2-oxoglutarate dehydrogenase, mitochondrial OS=Mus musculus GN=Ogdh PE=1 SV=3)

HSP 1 Score: 216.853 bits (551), Expect = 7.358e-56
Identity = 106/214 (49.53%), Postives = 145/214 (67.76%), Query Frame = 1
Query:    1 GLVVLLPHGYDGQGPEHSSARLERFLQMSDDNPFVIPEMDPTLR--KQIQECNWQIVNVTTPANYFHVLRRQIHRGFRKPLIVMSPKNLLRHKDCKSNLSEFDDVQGHPGFDKQGTRFKRLIKDQNGHSDLEEGIRRLVLCSGKVYYELDEERKKRSASD-VAICRVEQLCPFPYDLVQRELKRYPNAEIVWCQEEPMNMGAYTYISPRLATAM 633
            G+V+LLPHG +G GPEHSSAR ERFLQM +D+P V+P++        Q+ +CNW +VN +TP N+FHVLRRQI   FRKPLIV +PK+LLRH + +++  E             GT F+R+I +    +     ++RL+ C+GKVYY+L  ERK R+  + VAI R+EQL PFP+DL+ +E ++YPNAE+ WCQEE  N G Y Y+ PRL T +
Sbjct:  774 GIVLLLPHGMEGMGPEHSSARPERFLQMCNDDPDVLPDLQEENFDINQLYDCNWIVVNCSTPGNFFHVLRRQILLPFRKPLIVFTPKSLLRHPEARTSFDEM----------LPGTHFQRVIPENGPAAQDPHKVKRLLFCTGKVYYDLTRERKARNMEEEVAITRIEQLSPFPFDLLLKEAQKYPNAELAWCQEEHKNQGYYDYVKPRLRTTI 977          
BLAST of FC924883 vs. ExPASy Swiss-Prot
Match: ODO1_DICDI (2-oxoglutarate dehydrogenase, mitochondrial OS=Dictyostelium discoideum GN=ogdh PE=3 SV=1)

HSP 1 Score: 216.083 bits (549), Expect = 1.255e-55
Identity = 106/212 (50.00%), Postives = 136/212 (64.15%), Query Frame = 1
Query:    1 GLVVLLPHGYDGQGPEHSSARLERFLQMSDDNPFVIPEMDPTLRKQIQECNWQIVNVTTPANYFHVLRRQIHRGFRKPLIVMSPKNLLRHKDCKSNLSEFDDVQGHPGFDKQGTRFKRLIKDQNGHSDLEEGIRRLVLCSGKVYYELDEERKKRSASDVAICRVEQLCPFPYDLVQRELKRYPNAEIVWCQEEPMNMGAYTYISPRLATAMK 636
            GL +LLPHGYDG GPEHSS R+ER+LQ+ D +P  IP  +   RKQ Q CN Q++N +TP NYFH LRRQ+HR FRKPL++ +PK LLR++   S   EF +       D     +     DQ    +  E I R+V C+G+VYY L   R+  +  DVAI RVEQL PFP+DLV  +L+ YPNA+ +WCQEEPMNMG + YI P   +  K
Sbjct:  766 GLTMLLPHGYDGAGPEHSSCRIERYLQLCDSDPNKIPPKEEAERKQSQHCNMQVLNCSTPVNYFHALRRQVHRDFRKPLVIATPKYLLRYEKSFSTAKEFSN-------DSFTRLYPEAFPDQ---INKPEKINRIVFCTGQVYYNLIASRESNNIKDVAIIRVEQLHPFPFDLVAEQLQHYPNAKAIWCQEEPMNMGYWNYIYPYFISTFK 967          
The following BLAST results are available for this feature:
BLAST of FC924883 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 108
Match NameE-valueIdentityDescription
ODO1_XENLA3.191e-5953.522-oxoglutarate dehydrogenase, mitochondrial OS=Xen... [more]
ODO1_MACFA2.987e-5750.002-oxoglutarate dehydrogenase, mitochondrial OS=Mac... [more]
ODO1_HUMAN3.901e-5750.002-oxoglutarate dehydrogenase, mitochondrial OS=Hom... [more]
ODO1_PONAB1.483e-5649.532-oxoglutarate dehydrogenase, mitochondrial OS=Pon... [more]
ODO1_RAT1.936e-5650.002-oxoglutarate dehydrogenase, mitochondrial OS=Rat... [more]
ODO1_BOVIN3.303e-5649.532-oxoglutarate dehydrogenase, mitochondrial OS=Bos... [more]
OGDHL_HUMAN4.313e-5649.532-oxoglutarate dehydrogenase-like, mitochondrial O... [more]
OGDHL_PONAB7.358e-5649.532-oxoglutarate dehydrogenase-like, mitochondrial O... [more]
ODO1_MOUSE7.358e-5649.532-oxoglutarate dehydrogenase, mitochondrial OS=Mus... [more]
ODO1_DICDI1.255e-5550.002-oxoglutarate dehydrogenase, mitochondrial OS=Dic... [more]

Pages

back to top
Libraries
Library NameType
TFcdna_library
Properties
Property NameValue
Genbank descriptionKN0AAP1YL02FM1 TF Citrus clementina cDNA clone KN0AAP1YL02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC924883 ID=FC924883|Name=FC924883|organism=Citrus clementina|type=EST|length=644bp
GGACTTGTTGTGCTGCTCCCACATGGTTATGATGGTCAGGGCCCTGAACA
TTCAAGTGCACGATTGGAGCGTTTCCTTCAGATGAGTGATGACAATCCAT
TTGTTATACCTGAGATGGATCCAACTCTTCGGAAACAAATTCAAGAATGT
AACTGGCAGATTGTGAATGTTACAACTCCTGCTAATTATTTCCATGTTTT
GCGGCGTCAGATACACAGGGGATTCCGTAAGCCTCTCATCGTGATGTCAC
CCAAAAACCTGTTGCGTCACAAGGACTGCAAATCAAATCTTTCCGAGTTT
GATGATGTCCAAGGTCACCCTGGTTTTGACAAACAAGGGACCAGATTTAA
GCGGCTTATTAAGGATCAGAATGGGCACTCTGATCTTGAGGAGGGTATCA
GACGTCTGGTTCTTTGTTCTGGAAAGGTTTATTACGAGCTTGATGAAGAG
CGGAAGAAGCGCAGTGCAAGTGATGTTGCAATTTGCAGGGTGGAACAGCT
TTGTCCTTTCCCATATGACCTGGTTCAGCGTGAGCTTAAACGATATCCAA
ATGCCGAGATCGTTTGGTGCCAGGAAGAGCCAATGAACATGGGTGCGTAC
ACCTACATTTCACCCCGACTTGCCACTGCCATGAAAGCATTGGG
back to top