FC924889

Overview
NameFC924889
Unique NameFC924889
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length671
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC924889_ssr20 microsatellite FC924889_ssr20:20..34. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig1791 contig Ccv1_Contig1791:1..671. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC924889 vs. ExPASy Swiss-Prot
Match: FACR2_ARATH (Fatty acyl-CoA reductase 2 OS=Arabidopsis thaliana GN=FAR2 PE=2 SV=2)

HSP 1 Score: 142.124 bits (357), Expect = 2.473e-33
Identity = 91/201 (45.27%), Postives = 123/201 (61.19%), Query Frame = 3
Query:  135 MGALFLNSLS---VAPNKFVKAFENNCDLCLLRKKRSI----MHCQGGGKTTRSSG------VSPALKERSTVTDTAAGS-------LVLSPNGKGHAEIV--VQDLVPFGGQATSLVELQDGIGIVKFLKAKNFFVTGATGFLAKVLIEKILRTVPDVGKIFVLIKAKNEEAAMERLKNEIINAELFKCLKQTYGKSYQA 671
            M ALFL+S S   VA NK  +   +     ++R K+          GGG   R+S       VS  LK+R  V      S       LVLSPNG G    +  V+ L+PF G   S+V +++G+GI+ FL+ K F +TG+TGFLAKVLIEK+LR  PDV KI++LIKAK++EAA+ERLKNE+++AELF  LK+T+G SY +
Sbjct:    1 MEALFLSSSSSSIVASNKLTRLHNHCVWSTVIRDKKRFGPTWCRVGGGGDGGRNSNAERPIRVSSLLKDRGQVLIREQSSPAMDAETLVLSPNGNGRTIEINGVKTLMPFSG--ASMVGMKEGLGIISFLQGKKFLITGSTGFLAKVLIEKVLRMAPDVSKIYLLIKAKSKEAAIERLKNEVLDAELFNTLKETHGASYMS 199          
BLAST of FC924889 vs. ExPASy Swiss-Prot
Match: FACR6_ARATH (Fatty acyl-CoA reductase 6, chloroplastic OS=Arabidopsis thaliana GN=FAR6 PE=2 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 9.749e-22
Identity = 49/80 (61.25%), Postives = 70/80 (87.50%), Query Frame = 3
Query:  432 DGIGIVKFLKAKNFFVTGATGFLAKVLIEKILRTVPDVGKIFVLIKAKNEEAAMERLKNEIINAELFKCLKQTYGKSYQA 671
            DGIGIV+FL+ K++ VTGATGFLAKVLIEK+LR   ++GKIF+L+++K++E+A +RL +EII+++LFK LKQ +G SY+A
Sbjct:   73 DGIGIVRFLEGKSYLVTGATGFLAKVLIEKLLRESLEIGKIFLLMRSKDQESANKRLYDEIISSDLFKLLKQMHGSSYEA 152          
BLAST of FC924889 vs. ExPASy Swiss-Prot
Match: FACR5_ARATH (Probable fatty acyl-CoA reductase 5 OS=Arabidopsis thaliana GN=FAR5 PE=2 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 5.181e-15
Identity = 38/73 (52.05%), Postives = 53/73 (72.60%), Query Frame = 3
Query:  438 IGIVKFLKAKNFFVTGATGFLAKVLIEKILRTVPDVGKIFVLIKAKNEEAAMERLKNEIINAELFKCLKQTYG 656
            +  V+FL+ K   VTGATGFLAKV +EKILR  P+V K+++L++A + EAA +RL+ E+   ELFK L+Q  G
Sbjct:    3 LNCVQFLRNKTILVTGATGFLAKVFVEKILRVQPNVKKLYLLVRASDNEAATKRLRTEVFEKELFKVLRQNLG 75          
BLAST of FC924889 vs. ExPASy Swiss-Prot
Match: FACR1_ARATH (Fatty acyl-CoA reductase 1 OS=Arabidopsis thaliana GN=FAR1 PE=2 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 5.729e-14
Identity = 36/71 (50.70%), Postives = 55/71 (77.46%), Query Frame = 3
Query:  447 VKFLKAKNFFVTGATGFLAKVLIEKILRTVPDVGKIFVLIKAKNEEAAMERLKNEIINAELFKCLKQTYGK 659
            V+FL  K   +TGA GFLAKVL+EKILR  P+V KI++L++A +E++AM+RL++E++  +LFK L+   G+
Sbjct:    6 VQFLGNKTILITGAPGFLAKVLVEKILRLQPNVKKIYLLLRAPDEKSAMQRLRSEVMEIDLFKVLRNNLGE 76          
BLAST of FC924889 vs. ExPASy Swiss-Prot
Match: FACR8_ARATH (Fatty acyl-CoA reductase 8 OS=Arabidopsis thaliana GN=FAR8 PE=2 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 4.850e-13
Identity = 35/70 (50.00%), Postives = 49/70 (70.00%), Query Frame = 3
Query:  447 VKFLKAKNFFVTGATGFLAKVLIEKILRTVPDVGKIFVLIKAKNEEAAMERLKNEIINAELFKCLKQTYG 656
            V FL+ K   VTGATGFLAKV +EKILR  P+V K++++++A + EAA +RL+ E    +LFK L+   G
Sbjct:    6 VHFLQNKTILVTGATGFLAKVFVEKILRVQPNVNKLYLVVRASDNEAATKRLRTEAFEKDLFKVLRDNLG 75          
BLAST of FC924889 vs. ExPASy Swiss-Prot
Match: FACR3_ARATH (Fatty acyl-CoA reductase 3 OS=Arabidopsis thaliana GN=FAR3 PE=2 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.411e-12
Identity = 31/73 (42.47%), Postives = 51/73 (69.86%), Query Frame = 3
Query:  438 IGIVKFLKAKNFFVTGATGFLAKVLIEKILRTVPDVGKIFVLIKAKNEEAAMERLKNEIINAELFKCLKQTYG 656
            + ++K+L  K+  V GA GFLA + +EKILR  P+V K+++L++A   ++A +R  +EI+  +LFK LK+ YG
Sbjct:    8 VSVLKYLDNKSILVVGAAGFLANIFVEKILRVAPNVKKLYLLLRASKGKSATQRFNDEILKKDLFKVLKEKYG 80          
BLAST of FC924889 vs. ExPASy Swiss-Prot
Match: FACR4_ARATH (Probable fatty acyl-CoA reductase 4 OS=Arabidopsis thaliana GN=FAR4 PE=2 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 4.105e-12
Identity = 33/70 (47.14%), Postives = 48/70 (68.57%), Query Frame = 3
Query:  447 VKFLKAKNFFVTGATGFLAKVLIEKILRTVPDVGKIFVLIKAKNEEAAMERLKNEIINAELFKCLKQTYG 656
            ++FL  K   VTG  GFLAKV +EKILR  P V K+F+L++A + E+AM+R  +E++  +LF+ LK   G
Sbjct:    6 IQFLHDKTILVTGVPGFLAKVFVEKILRIQPKVKKLFLLLRAADNESAMQRFHSEVLEKDLFRVLKNALG 75          
The following BLAST results are available for this feature:
BLAST of FC924889 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 7
Match NameE-valueIdentityDescription
FACR2_ARATH2.473e-3345.27Fatty acyl-CoA reductase 2 OS=Arabidopsis thaliana... [more]
FACR6_ARATH9.749e-2261.25Fatty acyl-CoA reductase 6, chloroplastic OS=Arabi... [more]
FACR5_ARATH5.181e-1552.05Probable fatty acyl-CoA reductase 5 OS=Arabidopsis... [more]
FACR1_ARATH5.729e-1450.70Fatty acyl-CoA reductase 1 OS=Arabidopsis thaliana... [more]
FACR8_ARATH4.850e-1350.00Fatty acyl-CoA reductase 8 OS=Arabidopsis thaliana... [more]
FACR3_ARATH1.411e-1242.47Fatty acyl-CoA reductase 3 OS=Arabidopsis thaliana... [more]
FACR4_ARATH4.105e-1247.14Probable fatty acyl-CoA reductase 4 OS=Arabidopsis... [more]
back to top
Libraries
Library NameType
TFcdna_library
Properties
Property NameValue
Genbank descriptionKN0AAP1YL05FM1 TF Citrus clementina cDNA clone KN0AAP1YL05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC924889 ID=FC924889|Name=FC924889|organism=Citrus clementina|type=EST|length=671bp
TCTGCTCTTTTGATCAAGAAACCTAACCTAACCTAACCAAACCCTCTTCT
TATGTTTTTATAGAGATCAGTTAGTTTACTTGTTTATTTTTATTTTTATT
TTTTTGGCTTTCAGGAAGTGTGGCGGTGGAGATGATGGGGGCTTTGTTCC
TTAACTCCCTCTCAGTTGCACCAAATAAATTTGTCAAAGCCTTTGAGAAC
AATTGTGACCTGTGCTTGCTGAGGAAGAAAAGAAGCATAATGCATTGCCA
AGGTGGTGGCAAAACGACACGGTCCAGCGGCGTTTCTCCGGCTTTGAAAG
AGAGATCAACGGTAACGGATACAGCTGCTGGAAGCTTAGTTTTATCTCCG
AATGGGAAAGGCCATGCTGAGATTGTTGTTCAAGATTTGGTGCCTTTTGG
TGGACAAGCCACTTCTTTGGTAGAGTTGCAAGATGGAATTGGCATTGTCA
AATTTCTCAAAGCCAAAAATTTTTTCGTTACTGGGGCAACTGGGTTTCTA
GCAAAGGTGCTTATAGAGAAGATTTTACGAACGGTACCTGATGTGGGCAA
GATCTTTGTGCTGATCAAGGCAAAAAATGAAGAGGCTGCAATGGAGAGAT
TGAAAAATGAAATTATTAATGCAGAGCTTTTCAAGTGTCTGAAGCAAACT
TATGGAAAATCCTACCAAGCT
back to top