FC924890

Overview
NameFC924890
Unique NameFC924890
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length255
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig3643 contig Ccv1_Contig3643:2..256. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC924890 vs. ExPASy Swiss-Prot
Match: CRTZ_ESCVU (Beta-carotene hydroxylase OS=Escherichia vulneris GN=crtZ PE=4 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 4.476e-11
Identity = 37/83 (44.58%), Postives = 51/83 (61.45%), Query Frame = 1
Query:    7 HPFQHRPREGPFELNDVFAIINAVPAISLLSFGFFHKGLVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIADVPYFRR 255
            H   H PR+G FELND+FA++ A  AI+L++ G    G+ P    G G+  TV+G+ Y  VHDGLVH+R+P   I    Y +R
Sbjct:   35 HESHHTPRKGVFELNDLFAVVFAGVAIALIAVGT--AGVWPLQWIGCGM--TVYGLLYFLVHDGLVHQRWPFHWIPRRGYLKR 113          
The following BLAST results are available for this feature:
BLAST of FC924890 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
CRTZ_ESCVU4.476e-1144.58Beta-carotene hydroxylase OS=Escherichia vulneris ... [more]
back to top
Libraries
Library NameType
TFcdna_library
Properties
Property NameValue
Genbank descriptionKN0AAP6YM17FM1 TF Citrus clementina cDNA clone KN0AAP6YM17, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC924890 ID=FC924890|Name=FC924890|organism=Citrus clementina|type=EST|length=255bp
CATATGCACCCCTTTCAGCATCGACCAAGAGAGGGTCCTTTTGAGCTAAA
CGATGTGTTTGCCATAATCAACGCAGTTCCAGCCATTTCCCTTCTCTCTT
TTGGCTTCTTCCACAAAGGCCTTGTACCTGGTCTCTGTTTTGGTGCTGGA
CTTGGCATTACGGTGTTTGGGATGGCCTACATGTTCGTCCACGATGGTCT
CGTTCACAAAAGGTTCCCTGTGGGTCCCATTGCCGACGTGCCTTATTTCC
GGAGA
back to top