FC928836

Overview
NameFC928836
Unique NameFC928836
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length738
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig952 contig Ccv1_Contig952:1395..2132. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC928836 vs. ExPASy Swiss-Prot
Match: INO1_TOBAC (Inositol-3-phosphate synthase OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 271.552 bits (693), Expect = 3.206e-72
Identity = 134/135 (99.26%), Postives = 135/135 (100.00%), Query Frame = 3
Query:    6 PGEHPDHVVVIKYVPYVGDSKRAMDEYTSEIFMGGKNTIVLHNTCEDSLLAAPIVLDLVLLAELSTRIQLKAEGEGKFHSFHPVATILSYLTKAPLVPPGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 410
            PGEHPDHVVVIKYVPYVGDSKRAMDEYTSEIFMGGKNTIVLHNTCEDSLLAAPI+LDLVLLAELSTRIQLKAEGEGKFHSFHPVATILSYLTKAPLVPPGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK
Sbjct:  376 PGEHPDHVVVIKYVPYVGDSKRAMDEYTSEIFMGGKNTIVLHNTCEDSLLAAPIILDLVLLAELSTRIQLKAEGEGKFHSFHPVATILSYLTKAPLVPPGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 510          
BLAST of FC928836 vs. ExPASy Swiss-Prot
Match: INO1_NICPA (Inositol-3-phosphate synthase OS=Nicotiana paniculata GN=INPS1 PE=2 SV=1)

HSP 1 Score: 271.552 bits (693), Expect = 3.206e-72
Identity = 134/135 (99.26%), Postives = 135/135 (100.00%), Query Frame = 3
Query:    6 PGEHPDHVVVIKYVPYVGDSKRAMDEYTSEIFMGGKNTIVLHNTCEDSLLAAPIVLDLVLLAELSTRIQLKAEGEGKFHSFHPVATILSYLTKAPLVPPGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 410
            PGEHPDHVVVIKYVPYVGDSKRAMDEYTSEIFMGGKNTIVLHNTCEDSLLAAPI+LDLVLLAELSTRIQLKAEGEGKFHSFHPVATILSYLTKAPLVPPGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK
Sbjct:  376 PGEHPDHVVVIKYVPYVGDSKRAMDEYTSEIFMGGKNTIVLHNTCEDSLLAAPIILDLVLLAELSTRIQLKAEGEGKFHSFHPVATILSYLTKAPLVPPGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 510          
BLAST of FC928836 vs. ExPASy Swiss-Prot
Match: INO1_SESIN (Inositol-3-phosphate synthase OS=Sesamum indicum PE=2 SV=1)

HSP 1 Score: 269.24 bits (687), Expect = 1.591e-71
Identity = 132/135 (97.78%), Postives = 135/135 (100.00%), Query Frame = 3
Query:    6 PGEHPDHVVVIKYVPYVGDSKRAMDEYTSEIFMGGKNTIVLHNTCEDSLLAAPIVLDLVLLAELSTRIQLKAEGEGKFHSFHPVATILSYLTKAPLVPPGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 410
            PGEHPDH+VVIKYVPYVGDSKRAMDEYTSEIFMGGK+TIVLHNTCEDSLLAAPI+LDLVLLAELSTRIQLKAEGEGKFHSFHPVATILSYLTKAPLVPPGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK
Sbjct:  376 PGEHPDHIVVIKYVPYVGDSKRAMDEYTSEIFMGGKSTIVLHNTCEDSLLAAPIILDLVLLAELSTRIQLKAEGEGKFHSFHPVATILSYLTKAPLVPPGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 510          
BLAST of FC928836 vs. ExPASy Swiss-Prot
Match: INO1_MAIZE (Inositol-3-phosphate synthase OS=Zea mays PE=2 SV=2)

HSP 1 Score: 266.929 bits (681), Expect = 7.896e-71
Identity = 131/135 (97.04%), Postives = 134/135 (99.26%), Query Frame = 3
Query:    6 PGEHPDHVVVIKYVPYVGDSKRAMDEYTSEIFMGGKNTIVLHNTCEDSLLAAPIVLDLVLLAELSTRIQLKAEGEGKFHSFHPVATILSYLTKAPLVPPGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 410
            PGEHPDHVVVIKYVPYVGDSKRAMDEYTSEIFMGGKNTIVLHNTCEDSLLAAPI+LDLVLLAELSTRIQLKAEGE KFHSFHPVATILSYLTKAPLVPPGTPVVNAL+KQRAMLENI+RACVGLAPENNMILEYK
Sbjct:  376 PGEHPDHVVVIKYVPYVGDSKRAMDEYTSEIFMGGKNTIVLHNTCEDSLLAAPIILDLVLLAELSTRIQLKAEGEDKFHSFHPVATILSYLTKAPLVPPGTPVVNALAKQRAMLENIMRACVGLAPENNMILEYK 510          
BLAST of FC928836 vs. ExPASy Swiss-Prot
Match: INO1_WHEAT (Inositol-3-phosphate synthase OS=Triticum aestivum GN=MIPS PE=2 SV=1)

HSP 1 Score: 266.159 bits (679), Expect = 1.347e-70
Identity = 131/135 (97.04%), Postives = 133/135 (98.52%), Query Frame = 3
Query:    6 PGEHPDHVVVIKYVPYVGDSKRAMDEYTSEIFMGGKNTIVLHNTCEDSLLAAPIVLDLVLLAELSTRIQLKAEGEGKFHSFHPVATILSYLTKAPLVPPGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 410
            PGEHPDHVVVIKYVPYVGDSKRAMDEYTSEIFMGGKNTIV+HNTCEDSLLAAPI+LDLVLLAELSTRIQ KAEGEGKFHSFHPVATILSYLTKAPLVP GTPVVNALSKQRAMLENILRACVGLAPENNMILEYK
Sbjct:  376 PGEHPDHVVVIKYVPYVGDSKRAMDEYTSEIFMGGKNTIVMHNTCEDSLLAAPIILDLVLLAELSTRIQFKAEGEGKFHSFHPVATILSYLTKAPLVPAGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 510          
BLAST of FC928836 vs. ExPASy Swiss-Prot
Match: INO2_ARATH (Inositol-3-phosphate synthase isozyme 2 OS=Arabidopsis thaliana GN=At2g22240 PE=2 SV=2)

HSP 1 Score: 265.774 bits (678), Expect = 1.759e-70
Identity = 130/135 (96.30%), Postives = 133/135 (98.52%), Query Frame = 3
Query:    6 PGEHPDHVVVIKYVPYVGDSKRAMDEYTSEIFMGGKNTIVLHNTCEDSLLAAPIVLDLVLLAELSTRIQLKAEGEGKFHSFHPVATILSYLTKAPLVPPGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 410
            PGEHPDHVVVIKYVPYV DSKRAMDEYTSEIFMGG+NTIVLHNTCEDSLLAAPI+LDLVLLAELSTRIQ KAEGEGKFHSFHPVATILSYLTKAPLVPPGTPVVNALSKQRAMLENILRACVGLAPENNMI+EYK
Sbjct:  376 PGEHPDHVVVIKYVPYVADSKRAMDEYTSEIFMGGRNTIVLHNTCEDSLLAAPIILDLVLLAELSTRIQFKAEGEGKFHSFHPVATILSYLTKAPLVPPGTPVVNALSKQRAMLENILRACVGLAPENNMIMEYK 510          
BLAST of FC928836 vs. ExPASy Swiss-Prot
Match: INO1_SPIPO (Inositol-3-phosphate synthase OS=Spirodela polyrrhiza GN=TUR1 PE=2 SV=1)

HSP 1 Score: 263.462 bits (672), Expect = 8.730e-70
Identity = 128/135 (94.81%), Postives = 134/135 (99.26%), Query Frame = 3
Query:    6 PGEHPDHVVVIKYVPYVGDSKRAMDEYTSEIFMGGKNTIVLHNTCEDSLLAAPIVLDLVLLAELSTRIQLKAEGEGKFHSFHPVATILSYLTKAPLVPPGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 410
            PGEHPDHV+VIKYVPYVGDSKRAMDEYTSEIFMGGK+TI+LHNTCEDSLLAAPI+LDLVLLAELSTRIQLKAEGE KFHSFHPVA+ILSYL+KAPLVPPGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK
Sbjct:  376 PGEHPDHVIVIKYVPYVGDSKRAMDEYTSEIFMGGKSTIILHNTCEDSLLAAPIILDLVLLAELSTRIQLKAEGESKFHSFHPVASILSYLSKAPLVPPGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 510          
BLAST of FC928836 vs. ExPASy Swiss-Prot
Match: INO1_MESCR (Inositol-3-phosphate synthase OS=Mesembryanthemum crystallinum PE=2 SV=1)

HSP 1 Score: 262.692 bits (670), Expect = 1.489e-69
Identity = 130/135 (96.30%), Postives = 132/135 (97.78%), Query Frame = 3
Query:    6 PGEHPDHVVVIKYVPYVGDSKRAMDEYTSEIFMGGKNTIVLHNTCEDSLLAAPIVLDLVLLAELSTRIQLKAEGEGKFHSFHPVATILSYLTKAPLVPPGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 410
            PGEHPDHVVVIKYVPYVGDSKRAMDEYTSEIFMGG NTIV+HNTCEDSLLAAPI+LDLVLLAELSTRIQLKAE E KFHSFHPVATILSYLTKAPLVPPGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK
Sbjct:  378 PGEHPDHVVVIKYVPYVGDSKRAMDEYTSEIFMGGTNTIVMHNTCEDSLLAAPIILDLVLLAELSTRIQLKAEEEDKFHSFHPVATILSYLTKAPLVPPGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 512          
BLAST of FC928836 vs. ExPASy Swiss-Prot
Match: INO1_PHAVU (Inositol-3-phosphate synthase OS=Phaseolus vulgaris PE=2 SV=1)

HSP 1 Score: 262.307 bits (669), Expect = 1.945e-69
Identity = 126/135 (93.33%), Postives = 133/135 (98.52%), Query Frame = 3
Query:    6 PGEHPDHVVVIKYVPYVGDSKRAMDEYTSEIFMGGKNTIVLHNTCEDSLLAAPIVLDLVLLAELSTRIQLKAEGEGKFHSFHPVATILSYLTKAPLVPPGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 410
            PGEHPDHVVVIKYVPYV DSKRAMDEYTSEIFMGGKNTIV+HNTCEDSLLAAPI+LDLVLLAELSTRIQ K+EGEGKFHSFHPVATILSYLTKAPLVPPGTPV+NALSKQRAMLENI+RACVGLAPENNMI+E+K
Sbjct:  377 PGEHPDHVVVIKYVPYVADSKRAMDEYTSEIFMGGKNTIVMHNTCEDSLLAAPIILDLVLLAELSTRIQFKSEGEGKFHSFHPVATILSYLTKAPLVPPGTPVINALSKQRAMLENIMRACVGLAPENNMIMEFK 511          
BLAST of FC928836 vs. ExPASy Swiss-Prot
Match: INO1_ARATH (Inositol-3-phosphate synthase isozyme 1 OS=Arabidopsis thaliana GN=At4g39800 PE=2 SV=3)

HSP 1 Score: 262.307 bits (669), Expect = 1.945e-69
Identity = 126/135 (93.33%), Postives = 133/135 (98.52%), Query Frame = 3
Query:    6 PGEHPDHVVVIKYVPYVGDSKRAMDEYTSEIFMGGKNTIVLHNTCEDSLLAAPIVLDLVLLAELSTRIQLKAEGEGKFHSFHPVATILSYLTKAPLVPPGTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 410
            PGEHPDHVVVIKYVPYV DSKRAMDEYTSEIFMGGKNTIV+HNTCEDSLLAAPI+LDLVLLAELSTRIQ K+EGEGKFHSFHPVATILSYLTKAPLVPPGTPV+NALSKQRAMLENI+RACVGLAPENNMI+E+K
Sbjct:  377 PGEHPDHVVVIKYVPYVADSKRAMDEYTSEIFMGGKNTIVMHNTCEDSLLAAPIILDLVLLAELSTRIQFKSEGEGKFHSFHPVATILSYLTKAPLVPPGTPVINALSKQRAMLENIMRACVGLAPENNMIMEFK 511          
The following BLAST results are available for this feature:
BLAST of FC928836 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 27
Match NameE-valueIdentityDescription
INO1_TOBAC3.206e-7299.26Inositol-3-phosphate synthase OS=Nicotiana tabacum... [more]
INO1_NICPA3.206e-7299.26Inositol-3-phosphate synthase OS=Nicotiana panicul... [more]
INO1_SESIN1.591e-7197.78Inositol-3-phosphate synthase OS=Sesamum indicum P... [more]
INO1_MAIZE7.896e-7197.04Inositol-3-phosphate synthase OS=Zea mays PE=2 SV=... [more]
INO1_WHEAT1.347e-7097.04Inositol-3-phosphate synthase OS=Triticum aestivum... [more]
INO2_ARATH1.759e-7096.30Inositol-3-phosphate synthase isozyme 2 OS=Arabido... [more]
INO1_SPIPO8.730e-7094.81Inositol-3-phosphate synthase OS=Spirodela polyrrh... [more]
INO1_MESCR1.489e-6996.30Inositol-3-phosphate synthase OS=Mesembryanthemum ... [more]
INO1_PHAVU1.945e-6993.33Inositol-3-phosphate synthase OS=Phaseolus vulgari... [more]
INO1_ARATH1.945e-6993.33Inositol-3-phosphate synthase isozyme 1 OS=Arabido... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAH3AH01RM1 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH3AH01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC928836 ID=FC928836|Name=FC928836|organism=Citrus clementina|type=EST|length=738bp
ATGGGCCTGGTGAACACCCCGACCACGTTGTGGTCATCAAGTATGTGCCA
TATGTTGGCGATAGCAAGAGAGCCATGGATGAGTACACATCAGAAATTTT
CATGGGTGGCAAGAACACCATTGTGCTGCACAACACGTGTGAGGACTCTC
TTTTGGCTGCTCCAATCGTTCTAGATTTGGTTCTGCTGGCTGAACTCAGC
ACCAGGATCCAGCTCAAAGCTGAAGGAGAGGGCAAATTCCACTCTTTCCA
CCCTGTGGCTACAATTCTCAGCTACCTCACCAAGGCTCCTCTGGTCCCTC
CAGGCACACCAGTGGTGAATGCGCTGTCGAAGCAGCGTGCAATGCTTGAG
AACATTCTGAGGGCTTGCGTTGGCTTGGCTCCTGAGAACAACATGATTTT
GGAATACAAGTGAAGAACTTGCAGGGGAGAAAAGTGGAAGAACCGGTTTT
CCCTTTCTCTGTCACCAATCAAAGCTGTGGTGGTCCATTTAATTACTGAT
TGTAATGTCTTGTGTCATGAAATTGTGGTTAATATTAGTGTGTCCTGTAT
GTTTGCTCTTTTATTTTTTTAATGAAGGTGCTGGAGTGTAGCCCATTGCC
TTTGTAGCTCATTTCGGAGCATGAAATCTCTTGTATTGCAAGTAGATAAT
ATATGGAAGTTCATAAATAACTGTATTGCGGCAAATTTGAATCTCATCTA
AATCCTTACTTCTTAAAAAAAAAAAAAAAAAAAAAAAA
back to top