FC928840

Overview
NameFC928840
Unique NameFC928840
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length758
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9258 contig Ccv1_Contig9258:11..768. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC928840 vs. ExPASy Swiss-Prot
Match: PPR38_ARATH (Putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial OS=Arabidopsis thaliana GN=At1g12700 PE=3 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 5.644e-27
Identity = 60/162 (37.04%), Postives = 96/162 (59.26%), Query Frame = 1
Query:   13 HGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKNEI 498
            HGV  D   Y   +DGLC NG + +ALE+F  L+  K +L I  Y+ +I+G+CK G+++ AW LF SLP   +  +V+TY +MI  LC  G + +A+ L   ME  G AP+   +NTL+   +R+ + +   +L+  M       DAS++ +V+D+L+  E+
Sbjct:  432 HGVLPDVMTYGILLDGLCDNGKLEKALEIFEDLQKSKMDLGIVMYTTIIEGMCKGGKVEDAWNLFCSLPCKGVKPNVMTYTVMISGLCKKGSLSEANILLRKMEEDGNAPNDCTYNTLIRAHLRDGDLTASAKLIEEMKSCGFSADASSIKMVIDMLLSGEL 593          

HSP 2 Score: 99.3673 bits (246), Expect = 2.297e-20
Identity = 51/158 (32.28%), Postives = 88/158 (55.70%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            G   DT  + T I GL   G + EA+ L   +    C+ D+ +Y+ +++G+C+SG   +A +L   +    + ADV TY+ +I +LC DG +D A  LF +ME KG+    V +N+L+ G  +  + +    LL  M  R ++P+  T ++++D+ VK
Sbjct:  153 GYEPDTTTFNTLIKGLFLEGKVSEAVVLVDRMVENGCQPDVVTYNSIVNGICRSGDTSLALDLLRKMEERNVKADVFTYSTIIDSLCRDGCIDAAISLFKEMETKGIKSSVVTYNSLVRGLCKAGKWNDGALLLKDMVSREIVPNVITFNVLLDVFVK 310          

HSP 3 Score: 94.3597 bits (233), Expect = 7.389e-19
Identity = 44/152 (28.95%), Postives = 84/152 (55.26%), Query Frame = 1
Query:   19 VAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVV 474
            V AD + Y T ID LC++G I  A+ LF+ +     +  + +Y+ L+ GLCK+G+      L   +    ++ +V+T+N+++     +GK+ +A++L+ +M  +G++P+ + +NTLM G    N  S+   +L  M      PD  T + ++
Sbjct:  224 VKADVFTYSTIIDSLCRDGCIDAAISLFKEMETKGIKSSVVTYNSLVRGLCKAGKWNDGALLLKDMVSREIVPNVITFNVLLDVFVKEGKLQEANELYKEMITRGISPNIITYNTLMDGYCMQNRLSEANNMLDLMVRNKCSPDIVTFTSLI 375          

HSP 4 Score: 86.2705 bits (212), Expect = 2.012e-16
Identity = 44/155 (28.39%), Postives = 80/155 (51.61%), Query Frame = 1
Query:   13 HGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVD 477
            +G   D   Y + ++G+C++G    AL+L R +     + D+ +YS +ID LC+ G +  A  LF  +    + + VVTYN ++  LC  GK +    L  DM ++ + P+ + FN L+   ++  +  +  EL   M  R + P+  T + ++D
Sbjct:  187 NGCQPDVVTYNSIVNGICRSGDTSLALDLLRKMEERNVKADVFTYSTIIDSLCRDGCIDAAISLFKEMETKGIKSSVVTYNSLVRGLCKAGKWNDGALLLKDMVSREIVPNVITFNVLLDVFVKEGKLQEANELYKEMITRGISPNIITYNTLMD 341          

HSP 5 Score: 82.8037 bits (203), Expect = 2.225e-15
Identity = 40/139 (28.78%), Postives = 73/139 (52.52%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDE 432
            G++ +   Y T +DG C    + EA  +   +   KC  DI +++ LI G C   R+    ++F ++ +  L+A+ VTY+I++   C  GK+  A +LF +M + GV PD + +  L+ G   N +  K +E+   + +
Sbjct:  328 GISPNIITYNTLMDGYCMQNRLSEANNMLDLMVRNKCSPDIVTFTSLIKGYCMVKRVDDGMKVFRNISKRGLVANAVTYSILVQGFCQSGKIKLAEELFQEMVSHGVLPDVMTYGILLDGLCDNGKLEKALEIFEDLQK 466          

HSP 6 Score: 80.4925 bits (197), Expect = 1.104e-14
Identity = 41/160 (25.62%), Postives = 84/160 (52.50%), Query Frame = 1
Query:   10 RHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            R+  + D   + + I G C    + + +++FR +       +  +YS L+ G C+SG++K+A ELF  +    ++ DV+TY I++  LC +GK++KA ++F D++   +    V + T++ G  +  +      L   +  + V P+  T ++++  L K
Sbjct:  361 RNKCSPDIVTFTSLIKGYCMVKRVDDGMKVFRNISKRGLVANAVTYSILVQGFCQSGKIKLAEELFQEMVSHGVLPDVMTYGILLDGLCDNGKLEKALEIFEDLQKSKMDLGIVMYTTIIEGMCKGGKVEDAWNLFCSLPCKGVKPNVMTYTVMISGLCK 520          

HSP 7 Score: 69.707 bits (169), Expect = 1.949e-11
Identity = 39/151 (25.83%), Postives = 71/151 (47.02%), Query Frame = 1
Query:   40 YRTFIDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKN 492
            +   +D   K G + EA EL++ +       +I +Y+ L+DG C   RL  A  +   + R     D+VT+  +I   C   ++D    +F ++  +G+  + V ++ L+ G  ++ +     EL   M    V+PD  T  I++D L  N
Sbjct:  301 FNVLLDVFVKEGKLQEANELYKEMITRGISPNIITYNTLMDGYCMQNRLSEANNMLDLMVRNKCSPDIVTFTSLIKGYCMVKRVDDGMKVFRNISKRGLVANAVTYSILVQGFCQSGKIKLAEELFQEMVSHGVLPDVMTYGILLDGLCDN 451          
BLAST of FC928840 vs. ExPASy Swiss-Prot
Match: PP103_ARATH (Pentatricopeptide repeat-containing protein At1g64100 OS=Arabidopsis thaliana GN=At1g64100 PE=2 SV=2)

HSP 1 Score: 118.242 bits (295), Expect = 4.778e-26
Identity = 60/162 (37.04%), Postives = 89/162 (54.94%), Query Frame = 1
Query:   13 HGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKNEI 498
            HGV  DT      + G C+N  + EALELF  +++ K +LD  +Y+ +I G+CK  ++  AW+LF SLP   +  DV TYN+MI   C    +  A+ LF  M+  G  PD   +NTL+ GC++  E  K +EL+  M       DA T+ +V DL+    +
Sbjct:  496 HGVCPDTITCNILLYGFCENEKLEEALELFEVIQMSKIDLDTVAYNIIIHGMCKGSKVDEAWDLFCSLPIHGVEPDVQTYNVMISGFCGKSAISDANVLFHKMKDNGHEPDNSTYNTLIRGCLKAGEIDKSIELISEMRSNGFSGDAFTIKMVADLITDGRL 657          

HSP 2 Score: 86.6557 bits (213), Expect = 1.541e-16
Identity = 48/150 (32.00%), Postives = 74/150 (49.33%), Query Frame = 1
Query:   40 YRTFIDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            + T I+GLC  G ++EA  L   +      +D+ +Y  +++G+CK G  K A  L   +    +  DVV Y+ +I  LC DG    A  LF +M  KG+AP+   +N ++ G       S    LL  M ER + PD  T + ++   VK
Sbjct:  229 FNTLINGLCLEGRVLEAAALVNKMVGKGLHIDVVTYGTIVNGMCKMGDTKSALNLLSKMEETHIKPDVVIYSAIIDRLCKDGHHSDAQYLFSEMLEKGIAPNVFTYNCMIDGFCSFGRWSDAQRLLRDMIEREINPDVLTFNALISASVK 378          

HSP 3 Score: 82.4185 bits (202), Expect = 2.906e-15
Identity = 46/153 (30.07%), Postives = 72/153 (47.06%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVV 474
            G+  D   Y T ++G+CK G    AL L   +     + D+  YS +ID LCK G    A  LF  +    +  +V TYN MI   C+ G+   A  L  DM  + + PD + FN L+   ++  +  +  +L   M  R + PD  T + ++
Sbjct:  256 GLHIDVVTYGTIVNGMCKMGDTKSALNLLSKMEETHIKPDVVIYSAIIDRLCKDGHHSDAQYLFSEMLEKGIAPNVFTYNCMIDGFCSFGRWSDAQRLLRDMIEREINPDVLTFNALISASVKEGKLFEAEKLCDEMLHRCIFPDTVTYNSMI 408          

HSP 4 Score: 80.1073 bits (196), Expect = 1.442e-14
Identity = 43/154 (27.92%), Postives = 75/154 (48.70%), Query Frame = 1
Query:   28 DTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            DT  Y + I G CK+    +A  +F     L    D+ +++ +ID  C++ R+    +L   + R  L+A+  TYN +IH  C    ++ A DLF +M + GV PD +  N L+ G   N +  + +EL   +    +  D    +I++  + K
Sbjct:  400 DTVTYNSMIYGFCKHNRFDDAKHMFD----LMASPDVVTFNTIIDVYCRAKRVDEGMQLLREISRRGLVANTTTYNTLIHGFCEVDNLNAAQDLFQEMISHGVCPDTITCNILLYGFCENEKLEEALELFEVIQMSKIDLDTVAYNIIIHGMCK 549          

HSP 5 Score: 74.3294 bits (181), Expect = 7.913e-13
Identity = 43/154 (27.92%), Postives = 75/154 (48.70%), Query Frame = 1
Query:   19 VAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDL 480
            +  D   Y   ID LCK+G+  +A  LF  +       ++ +Y+C+IDG C  GR   A  L   +    +  DV+T+N +I A   +GK+ +A  L  +M  + + PD V +N+++ G  ++N       +   M      PD  T + ++D+
Sbjct:  292 IKPDVVIYSAIIDRLCKDGHHSDAQYLFSEMLEKGIAPNVFTYNCMIDGFCSFGRWSDAQRLLRDMIEREINPDVLTFNALISASVKEGKLFEAEKLCDEMLHRCIFPDTVTYNSMIYGFCKHNRFDDAKHMFDLM----ASPDVVTFNTIIDV 441          

HSP 6 Score: 71.633 bits (174), Expect = 5.129e-12
Identity = 43/153 (28.10%), Postives = 75/153 (49.02%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVV 474
            G+A + + Y   IDG C  G   +A  L R +   +   D+ +++ LI    K G+L  A +L   +    +  D VTYN MI+  C   + D A  +F D+ A   +PD V FNT++    R     + ++LL  +  R ++ + +T + ++
Sbjct:  326 GIAPNVFTYNCMIDGFCSFGRWSDAQRLLRDMIEREINPDVLTFNALISASVKEGKLFEAEKLCDEMLHRCIFPDTVTYNSMIYGFCKHNRFDDAKHMF-DLMA---SPDVVTFNTIIDVYCRAKRVDEGMQLLREISRRGLVANTTTYNTLI 474          

HSP 7 Score: 69.707 bits (169), Expect = 1.949e-11
Identity = 46/184 (25.00%), Postives = 75/184 (40.76%), Query Frame = 1
Query:   28 DTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLID-----------------------------------GLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVV 474
            D   + T ID  C+   + E ++L R +       +  +Y+ LI                                    G C++ +L+ A ELF  +    +  D V YNI+IH +C   K+D+A DLF  +   GV PD   +N ++ G    +  S    L H+M +    PD ST + ++
Sbjct:  431 DVVTFNTIIDVYCRAKRVDEGMQLLREISRRGLVANTTTYNTLIHGFCEVDNLNAAQDLFQEMISHGVCPDTITCNILLYGFCENEKLEEALELFEVIQMSKIDLDTVAYNIIIHGMCKGSKVDEAWDLFCSLPIHGVEPDVQTYNVMISGFCGKSAISDANVLFHKMKDNGHEPDNSTYNTLI 614          

HSP 8 Score: 67.781 bits (164), Expect = 7.406e-11
Identity = 45/173 (26.01%), Postives = 83/173 (47.98%), Query Frame = 1
Query:   19 VAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELF-HSLPRGVLIAD--------------VVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKN 492
            +  + +++   I   C    +  +L  F  L  L  + D+ +++ L+ GLC   R+  A  LF + +  G L A               V+T+N +I+ LC +G++ +A  L   M  KG+  D V + T++ G  +  +T   + LL +M+E ++ PD    S ++D L K+
Sbjct:  137 IPLNIYSFNILIKCFCDCHKLSFSLSTFGKLTKLGFQPDVVTFNTLLHGLCLEDRISEALALFGYMVETGFLEAVALFDQMVEIGLTPVVITFNTLINGLCLEGRVLEAAALVNKMVGKGLHIDVVTYGTIVNGMCKMGDTKSALNLLSKMEETHIKPDVVIYSAIIDRLCKD 309          
BLAST of FC928840 vs. ExPASy Swiss-Prot
Match: PPR98_ARATH (Pentatricopeptide repeat-containing protein At1g63080, mitochondrial OS=Arabidopsis thaliana GN=At1g63080 PE=2 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 2.008e-24
Identity = 57/156 (36.54%), Postives = 90/156 (57.69%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLL 483
            GV  +   Y T +DGLCKNG + +A+ +F  L+  K E DI +Y+ + +G+CK+G+++  W+LF SL    +  DV+ YN MI   C  G  ++A+ LF+ M+  G  PD   +NTL+   +R+ + +   EL+  M       DAST  +V D+L
Sbjct:  445 GVHPNIMTYNTLLDGLCKNGKLEKAMVVFEYLQKSKMEPDIYTYNIMSEGMCKAGKVEDGWDLFCSLSLKGVKPDVIAYNTMISGFCKKGLKEEAYTLFIKMKEDGPLPDSGTYNTLIRAHLRDGDKAASAELIKEMRSCRFAGDASTYGLVTDML 600          

HSP 2 Score: 94.3597 bits (233), Expect = 7.389e-19
Identity = 49/155 (31.61%), Postives = 82/155 (52.90%), Query Frame = 1
Query:   10 RHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVV 474
            R G+  +T  Y T I G  +      A  +F+ +       +I +Y+ L+DGLCK+G+L+ A  +F  L +  +  D+ TYNIM   +C  GK++   DLF  +  KGV PD +A+NT++ G  +     +   L  +M E   +PD+ T + ++
Sbjct:  408 RRGLVGNTVTYTTLIHGFFQASDCDNAQMVFKQMVSDGVHPNIMTYNTLLDGLCKNGKLEKAMVVFEYLQKSKMEPDIYTYNIMSEGMCKAGKVEDGWDLFCSLSLKGVKPDVIAYNTMISGFCKKGLKEEAYTLFIKMKEDGPLPDSGTYNTLI 562          

HSP 3 Score: 91.2781 bits (225), Expect = 6.255e-18
Identity = 49/158 (31.01%), Postives = 83/158 (52.53%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            G   DT  + T + GL ++    EA+ L   + +  C+ D+ +Y  +I+GLCK G   +A  L + + +G + ADVV Y+ +I +LC    +D A +LF +M+ KG+ PD   +++L+         S    LL  M ER + P+  T + ++D   K
Sbjct:  165 GYQPDTVTFTTLVHGLFQHNKASEAVALVERMVVKGCQPDLVTYGAVINGLCKRGEPDLALNLLNKMEKGKIEADVVIYSTVIDSLCKYRHVDDALNLFTEMDNKGIRPDVFTYSSLISCLCNYGRWSDASRLLSDMLERKINPNVVTFNSLIDAFAK 322          

HSP 4 Score: 83.9593 bits (206), Expect = 9.986e-16
Identity = 43/150 (28.67%), Postives = 78/150 (52.00%), Query Frame = 1
Query:   40 YRTFIDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            Y + I+G C +  + EA ++F  +    C  D+ +Y+ LI+G CK+ ++    ELF  + R  L+ + VTY  +IH        D A  +F  M + GV P+ + +NTL+ G  +N +  K + +   + +  + PD  T +I+ + + K
Sbjct:  348 YNSLINGFCMHDRLDEAQQIFTLMVSKDCLPDVVTYNTLINGFCKAKKVVDGMELFRDMSRRGLVGNTVTYTTLIHGFFQASDCDNAQMVFKQMVSDGVHPNIMTYNTLLDGLCKNGKLEKAMVVFEYLQKSKMEPDIYTYNIMSEGMCK 497          

HSP 5 Score: 80.1073 bits (196), Expect = 1.442e-14
Identity = 47/169 (27.81%), Postives = 86/169 (50.89%), Query Frame = 1
Query:   19 VAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKNEISLNSIPQFK 525
            + AD   Y T ID LCK  ++ +AL LF  +       D+ +YS LI  LC  GR   A  L   +    +  +VVT+N +I A   +GK+ +A  LF +M  + + P+ V +N+L+ G   ++   +  ++   M  ++ +PD  T + +++   K +  ++ +  F+
Sbjct:  236 IEADVVIYSTVIDSLCKYRHVDDALNLFTEMDNKGIRPDVFTYSSLISCLCNYGRWSDASRLLSDMLERKINPNVVTFNSLIDAFAKEGKLIEAEKLFDEMIQRSIDPNIVTYNSLINGFCMHDRLDEAQQIFTLMVSKDCLPDVVTYNTLINGFCKAKKVVDGMELFR 404          

HSP 6 Score: 77.0258 bits (188), Expect = 1.221e-13
Identity = 42/153 (27.45%), Postives = 77/153 (50.33%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVV 474
            G+  D + Y + I  LC  G   +A  L   +   K   ++ +++ LID   K G+L  A +LF  + +  +  ++VTYN +I+  C   ++D+A  +F  M +K   PD V +NTL+ G  +  +    +EL   M  R ++ +  T + ++
Sbjct:  270 GIRPDVFTYSSLISCLCNYGRWSDASRLLSDMLERKINPNVVTFNSLIDAFAKEGKLIEAEKLFDEMIQRSIDPNIVTYNSLINGFCMHDRLDEAQQIFTLMVSKDCLPDVVTYNTLINGFCKAKKVVDGMELFRDMSRRGLVGNTVTYTTLI 422          

HSP 7 Score: 76.6406 bits (187), Expect = 1.594e-13
Identity = 44/151 (29.14%), Postives = 77/151 (50.99%), Query Frame = 1
Query:   40 YRTFIDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKN 492
            + + ID   K G ++EA +LF  +     + +I +Y+ LI+G C   RL  A ++F  +     + DVVTYN +I+  C   K+    +LF DM  +G+  + V + TL+ G  + ++      +  +M    V P+  T + ++D L KN
Sbjct:  313 FNSLIDAFAKEGKLIEAEKLFDEMIQRSIDPNIVTYNSLINGFCMHDRLDEAQQIFTLMVSKDCLPDVVTYNTLINGFCKAKKVVDGMELFRDMSRRGLVGNTVTYTTLIHGFFQASDCDNAQMVFKQMVSDGVHPNIMTYNTLLDGLCKN 463          

HSP 8 Score: 76.2554 bits (186), Expect = 2.082e-13
Identity = 47/154 (30.52%), Postives = 74/154 (48.05%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVD 477
            G   D   Y   I+GLCK G    AL L   +   K E D+  YS +ID LCK   +  A  LF  +    +  DV TY+ +I  LC  G+   A  L  DM  + + P+ V FN+L+    +  +  +  +L   M +R++ P+  T + +++
Sbjct:  200 GCQPDLVTYGAVINGLCKRGEPDLALNLLNKMEKGKIEADVVIYSTVIDSLCKYRHVDDALNLFTEMDNKGIRPDVFTYSSLISCLCNYGRWSDASRLLSDMLERKINPNVVTFNSLIDAFAKEGKLIEAEKLFDEMIQRSIDPNIVTYNSLIN 353          
BLAST of FC928840 vs. ExPASy Swiss-Prot
Match: PPR99_ARATH (Pentatricopeptide repeat-containing protein At1g63130, mitochondrial OS=Arabidopsis thaliana GN=At1g63130 PE=2 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 1.301e-23
Identity = 56/156 (35.90%), Postives = 90/156 (57.69%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLL 483
            GV  D   Y   +DGLC NG +  AL +F  L+  K E DI +Y+ +I+G+CK+G+++  W+LF SL    +  +VVTY  M+   C  G  ++A  LF +M+ +G  PD   +NTL+   +R+ + +   EL+  M     + DAST+ +V ++L
Sbjct:  461 GVLPDIMTYSILLDGLCNNGKVETALVVFEYLQRSKMEPDIYTYNIMIEGMCKAGKVEDGWDLFCSLSLKGVKPNVVTYTTMMSGFCRKGLKEEADALFREMKEEGPLPDSGTYNTLIRAHLRDGDKAASAELIREMRSCRFVGDASTIGLVTNML 616          

HSP 2 Score: 92.8189 bits (229), Expect = 2.150e-18
Identity = 50/158 (31.65%), Postives = 84/158 (53.16%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            G   D++ + T I GL ++    EA+ L   + +  C+ D+ +Y  +++GLCK G + +A  L   + +G +   VV YN +I ALC    ++ A +LF +M+ KG+ P+ V +N+L+         S    LL  M ER + P+  T S ++D  VK
Sbjct:  181 GYQPDSFTFNTLIHGLFRHNRASEAVALVDRMVVKGCQPDLVTYGIVVNGLCKRGDIDLALSLLKKMEQGKIEPGVVIYNTIIDALCNYKNVNDALNLFTEMDNKGIRPNVVTYNSLIRCLCNYGRWSDASRLLSDMIERKINPNVVTFSALIDAFVK 338          

HSP 3 Score: 80.4925 bits (197), Expect = 1.104e-14
Identity = 41/160 (25.62%), Postives = 78/160 (48.75%), Query Frame = 1
Query:   10 RHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            +  +  D + Y + I+G C +  + EA  +F  +    C  ++ +Y+ LI G CK+ R+    ELF  + +  L+ + VTY  +IH      + D A  +F  M + GV PD + ++ L+ G   N +    + +   +    + PD  T +I+++ + K
Sbjct:  354 KRSIDPDIFTYSSLINGFCMHDRLDEAKHMFELMISKDCFPNVVTYNTLIKGFCKAKRVDEGMELFREMSQRGLVGNTVTYTTLIHGFFQARECDNAQIVFKQMVSDGVLPDIMTYSILLDGLCNNGKVETALVVFEYLQRSKMEPDIYTYNIMIEGMCK 513          

HSP 4 Score: 79.7221 bits (195), Expect = 1.883e-14
Identity = 47/151 (31.13%), Postives = 75/151 (49.67%), Query Frame = 1
Query:   40 YRTFIDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKN 492
            +   ID   K G +VEA +L+  +     + DI +YS LI+G C   RL  A  +F  +       +VVTYN +I   C   ++D+  +LF +M  +G+  + V + TL+ G  +  E      +  +M    V+PD  T SI++D L  N
Sbjct:  329 FSALIDAFVKEGKLVEAEKLYDEMIKRSIDPDIFTYSSLINGFCMHDRLDEAKHMFELMISKDCFPNVVTYNTLIKGFCKAKRVDEGMELFREMSQRGLVGNTVTYTTLIHGFFQARECDNAQIVFKQMVSDGVLPDIMTYSILLDGLCNN 479          

HSP 5 Score: 76.6406 bits (187), Expect = 1.594e-13
Identity = 46/154 (29.87%), Postives = 75/154 (48.70%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVD 477
            G   D   Y   ++GLCK G I  AL L + +   K E  +  Y+ +ID LC    +  A  LF  +    +  +VVTYN +I  LC  G+   A  L  DM  + + P+ V F+ L+   ++  +  +  +L   M +R++ PD  T S +++
Sbjct:  216 GCQPDLVTYGIVVNGLCKRGDIDLALSLLKKMEQGKIEPGVVIYNTIIDALCNYKNVNDALNLFTEMDNKGIRPNVVTYNSLIRCLCNYGRWSDASRLLSDMIERKINPNVVTFSALIDAFVKEGKLVEAEKLYDEMIKRSIDPDIFTYSSLIN 369          

HSP 6 Score: 70.4774 bits (171), Expect = 1.143e-11
Identity = 39/153 (25.49%), Postives = 76/153 (49.67%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVV 474
            G+  +   Y + I  LC  G   +A  L   +   K   ++ ++S LID   K G+L  A +L+  + +  +  D+ TY+ +I+  C   ++D+A  +F  M +K   P+ V +NTL+ G  +     + +EL   M +R ++ +  T + ++
Sbjct:  286 GIRPNVVTYNSLIRCLCNYGRWSDASRLLSDMIERKINPNVVTFSALIDAFVKEGKLVEAEKLYDEMIKRSIDPDIFTYSSLINGFCMHDRLDEAKHMFELMISKDCFPNVVTYNTLIKGFCKAKRVDEGMELFREMSQRGLVGNTVTYTTLI 438          
BLAST of FC928840 vs. ExPASy Swiss-Prot
Match: PPR36_ARATH (Pentatricopeptide repeat-containing protein At1g12300, mitochondrial OS=Arabidopsis thaliana GN=At1g12300 PE=2 SV=1)

HSP 1 Score: 109.768 bits (273), Expect = 1.699e-23
Identity = 58/148 (39.19%), Postives = 86/148 (58.11%), Query Frame = 1
Query:   40 YRTFIDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLL 483
            Y+  +DGLC NG   +ALE+F  +   K ELDI  Y+ +I G+C + ++  AW+LF SLP   +   V TYNIMI  LC  G + +A  LF  ME  G APD   +N L+   + + + +K V+L+  +       DAST+ +V+D+L
Sbjct:  476 YKILLDGLCDNGESEKALEIFEKIEKSKMELDIGIYNIIIHGMCNASKVDDAWDLFCSLPLKGVKPGVKTYNIMIGGLCKKGPLSEAELLFRKMEEDGHAPDGWTYNILIRAHLGDGDATKSVKLIEELKRCGFSVDASTIKMVIDML 623          

HSP 2 Score: 102.449 bits (254), Expect = 2.713e-21
Identity = 54/153 (35.29%), Postives = 82/153 (53.59%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVV 474
            GV ADT  Y T I G C+ G +  A ELF+ +   K   +I +Y  L+DGLC +G  + A E+F  + +  +  D+  YNI+IH +C   K+D A DLF  +  KGV P    +N ++ G  +    S+   L  +M+E    PD  T +I++
Sbjct:  433 GVVADTVTYNTLIQGFCELGKLNVAKELFQEMVSRKVPPNIVTYKILLDGLCDNGESEKALEIFEKIEKSKMELDIGIYNIIIHGMCNASKVDDAWDLFCSLPLKGVKPGVKTYNIMIGGLCKKGPLSEAELLFRKMEEDGHAPDGWTYNILI 585          

HSP 3 Score: 97.8265 bits (242), Expect = 6.683e-20
Identity = 47/153 (30.72%), Postives = 87/153 (56.86%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVV 474
            G+A DT  Y + IDG CK  ++ +A ++   +    C+ +I +++ LI+G CK+ R+    ELF  +    ++AD VTYN +I   C  GK++ A +LF +M ++ V P+ V +  L+ G   N E+ K +E+  ++++  +  D    +I++
Sbjct:  363 GIAPDTITYTSLIDGFCKENHLDKANQMVDLMVSKGCDPNIRTFNILINGYCKANRIDDGLELFRKMSLRGVVADTVTYNTLIQGFCELGKLNVAKELFQEMVSRKVPPNIVTYKILLDGLCDNGESEKALEIFEKIEKSKMELDIGIYNIII 515          

HSP 4 Score: 90.8929 bits (224), Expect = 8.169e-18
Identity = 47/155 (30.32%), Postives = 79/155 (50.97%), Query Frame = 1
Query:   13 HGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVD 477
            +G   +   Y   ++ +CK+G    A+EL R +     +LD   YS +IDGLCK G L  A+ LF+ +    +  +++TYNI+I   C  G+ D    L  DM  + + P+ V F+ L+   ++  +  +  EL   M  R + PD  T + ++D
Sbjct:  222 YGCQPNAVTYGPVLNVMCKSGQTALAMELLRKMEERNIKLDAVKYSIIIDGLCKHGSLDNAFNLFNEMEMKGITTNIITYNILIGGFCNAGRWDDGAKLLRDMIKRKINPNVVTFSVLIDSFVKEGKLREAEELHKEMIHRGIAPDTITYTSLID 376          

HSP 5 Score: 88.9669 bits (219), Expect = 3.104e-17
Identity = 48/158 (30.38%), Postives = 81/158 (51.27%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            G   D     T ++GLC +G   EA+ L   +    C+ +  +Y  +++ +CKSG+  +A EL   +    +  D V Y+I+I  LC  G +D A +LF +ME KG+  + + +N L+ G           +LL  M +R + P+  T S+++D  VK
Sbjct:  188 GHKPDLITINTLVNGLCLSGKEAEAMLLIDKMVEYGCQPNAVTYGPVLNVMCKSGQTALAMELLRKMEERNIKLDAVKYSIIIDGLCKHGSLDNAFNLFNEMEMKGITTNIITYNILIGGFCNAGRWDDGAKLLRDMIKRKINPNVVTFSVLIDSFVK 345          

HSP 6 Score: 84.7297 bits (208), Expect = 5.855e-16
Identity = 42/153 (27.45%), Postives = 82/153 (53.59%), Query Frame = 1
Query:   19 VAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVD 477
            +  D   Y   IDGLCK+G +  A  LF  + +     +I +Y+ LI G C +GR     +L   + +  +  +VVT++++I +   +GK+ +A +L  +M  +G+APD + + +L+ G  + N   K  +++  M  +   P+  T +I+++
Sbjct:  259 IKLDAVKYSIIIDGLCKHGSLDNAFNLFNEMEMKGITTNIITYNILIGGFCNAGRWDDGAKLLRDMIKRKINPNVVTFSVLIDSFVKEGKLREAEELHKEMIHRGIAPDTITYTSLIDGFCKENHLDKANQMVDLMVSKGCDPNIRTFNILIN 411          

HSP 7 Score: 78.5666 bits (192), Expect = 4.196e-14
Identity = 46/152 (30.26%), Postives = 79/152 (51.97%), Query Frame = 1
Query:   43 RTF---IDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            RTF   I+G CK   I + LELFR + +     D  +Y+ LI G C+ G+L +A ELF  +    +  ++VTY I++  LC +G+ +KA ++F  +E   +  D   +N ++ G    ++     +L   +  + V P   T +I++  L K
Sbjct:  404 RTFNILINGYCKANRIDDGLELFRKMSLRGVVADTVTYNTLIQGFCELGKLNVAKELFQEMVSRKVPPNIVTYKILLDGLCDNGESEKALEIFEKIEKSKMELDIGIYNIIIHGMCNASKVDDAWDLFCSLPLKGVKPGVKTYNIMIGGLCK 555          

HSP 8 Score: 75.8702 bits (185), Expect = 2.720e-13
Identity = 43/153 (28.10%), Postives = 72/153 (47.06%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVV 474
            G+  +   Y   I G C  G   +  +L R +   K   ++ ++S LID   K G+L+ A EL   +    +  D +TY  +I   C +  +DKA+ +   M +KG  P+   FN L+ G  + N     +EL  +M  R V+ D  T + ++
Sbjct:  293 GITTNIITYNILIGGFCNAGRWDDGAKLLRDMIKRKINPNVVTFSVLIDSFVKEGKLREAEELHKEMIHRGIAPDTITYTSLIDGFCKENHLDKANQMVDLMVSKGCDPNIRTFNILINGYCKANRIDDGLELFRKMSLRGVVADTVTYNTLI 445          

HSP 9 Score: 74.3294 bits (181), Expect = 7.913e-13
Identity = 48/162 (29.63%), Postives = 76/162 (46.91%), Query Frame = 1
Query:   40 YRTFIDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKNEISLNSIPQFK 525
            +   ID   K G + EA EL + +       D  +Y+ LIDG CK   L  A ++   +       ++ T+NI+I+  C   ++D   +LF  M  +GV  D V +NTL+ G     + +   EL   M  R V P+  T  I++D L  N  S  ++  F+
Sbjct:  336 FSVLIDSFVKEGKLREAEELHKEMIHRGIAPDTITYTSLIDGFCKENHLDKANQMVDLMVSKGCDPNIRTFNILINGYCKANRIDDGLELFRKMSLRGVVADTVTYNTLIQGFCELGKLNVAKELFQEMVSRKVPPNIVTYKILLDGLCDNGESEKALEIFE 497          

HSP 10 Score: 72.7886 bits (177), Expect = 2.302e-12
Identity = 46/159 (28.93%), Postives = 80/159 (50.31%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKN 492
            G+A + +     I+  C+   +  A      +  L  E +  ++S LI+GLC  GR+  A EL   +       D++T N +++ LC  GK  +A  L   M   G  P+ V +  ++    ++ +T+  +ELL +M+ERN+  DA   SI++D L K+
Sbjct:  118 GIAHNLYTLSIMINCFCRCRKLCLAFSAMGKIIKLGYEPNTITFSTLINGLCLEGRVSEALELVDRMVEMGHKPDLITINTLVNGLCLSGKEAEAMLLIDKMVEYGCQPNAVTYGPVLNVMCKSGQTALAMELLRKMEERNIKLDAVKYSIIIDGLCKH 276          
BLAST of FC928840 vs. ExPASy Swiss-Prot
Match: PPR39_ARATH (Pentatricopeptide repeat-containing protein At1g12775, mitochondrial OS=Arabidopsis thaliana GN=At1g12775 PE=2 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 2.220e-23
Identity = 58/172 (33.72%), Postives = 92/172 (53.49%), Query Frame = 1
Query:   19 VAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKNEISLNSIPQFKSQR 534
            V  D  +Y+  +DGLC NG + +ALE+F  +   K ELDI  Y  +I G+C + ++  AW+LF SLP   +  D   YNIMI  LC    + KA  LF  M  +G APD + +N L+   + +++ +   EL+  M       D ST+ +V+++L   E+  + +    + R
Sbjct:  469 VRPDIVSYKILLDGLCDNGELEKALEIFGKIEKSKMELDIGIYMIIIHGMCNASKVDDAWDLFCSLPLKGVKLDARAYNIMISELCRKDSLSKADILFRKMTEEGHAPDELTYNILIRAHLGDDDATTAAELIEEMKSSGFPADVSTVKMVINMLSSGELDKSFLDMLSTTR 640          

HSP 2 Score: 101.679 bits (252), Expect = 4.628e-21
Identity = 54/153 (35.29%), Postives = 83/153 (54.25%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVV 474
            GV A+T  Y T + G C++G +  A +LF+ +   +   DI SY  L+DGLC +G L+ A E+F  + +  +  D+  Y I+IH +C   K+D A DLF  +  KGV  D  A+N ++    R +  SK   L  +M E    PD  T +I++
Sbjct:  433 GVIANTVTYNTLVQGFCQSGKLEVAKKLFQEMVSRRVRPDIVSYKILLDGLCDNGELEKALEIFGKIEKSKMELDIGIYMIIIHGMCNASKVDDAWDLFCSLPLKGVKLDARAYNIMISELCRKDSLSKADILFRKMTEEGHAPDELTYNILI 585          

HSP 3 Score: 99.7525 bits (247), Expect = 1.759e-20
Identity = 48/155 (30.97%), Postives = 86/155 (55.48%), Query Frame = 1
Query:   10 RHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVV 474
            + G+A +T  Y + IDG CK   + EA+++   +    C+ DI +++ LI+G CK+ R+    ELF  +    +IA+ VTYN ++   C  GK++ A  LF +M ++ V PD V++  L+ G   N E  K +E+  ++++  +  D     I++
Sbjct:  361 QRGIAPNTITYNSLIDGFCKENRLEEAIQMVDLMISKGCDPDIMTFNILINGYCKANRIDDGLELFREMSLRGVIANTVTYNTLVQGFCQSGKLEVAKKLFQEMVSRRVRPDIVSYKILLDGLCDNGELEKALEIFGKIEKSKMELDIGIYMIII 515          

HSP 4 Score: 91.6633 bits (226), Expect = 4.789e-18
Identity = 44/153 (28.76%), Postives = 84/153 (54.90%), Query Frame = 1
Query:   19 VAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVD 477
            +  D   Y   IDGLCK+G +  A  LF  + I   + DI +Y+ LI G C +GR     +L   + +  +  +VVT++++I +   +GK+ +A  L  +M  +G+AP+ + +N+L+ G  + N   + ++++  M  +   PD  T +I+++
Sbjct:  259 IKLDAVKYSIIIDGLCKDGSLDNAFNLFNEMEIKGFKADIITYNTLIGGFCNAGRWDDGAKLLRDMIKRKISPNVVTFSVLIDSFVKEGKLREADQLLKEMMQRGIAPNTITYNSLIDGFCKENRLEEAIQMVDLMISKGCDPDIMTFNILIN 411          

HSP 5 Score: 90.8929 bits (224), Expect = 8.169e-18
Identity = 48/148 (32.43%), Postives = 80/148 (54.05%), Query Frame = 1
Query:   46 TFIDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            T ++GLC NG + +A+ L   +     + +  +Y  +++ +CKSG+  +A EL   +    +  D V Y+I+I  LC DG +D A +LF +ME KG   D + +NTL+ G           +LL  M +R + P+  T S+++D  VK
Sbjct:  198 TLVNGLCLNGKVSDAVVLIDRMVETGFQPNEVTYGPVLNVMCKSGQTALAMELLRKMEERNIKLDAVKYSIIIDGLCKDGSLDNAFNLFNEMEIKGFKADIITYNTLIGGFCNAGRWDDGAKLLRDMIKRKISPNVVTFSVLIDSFVK 345          

HSP 6 Score: 90.5077 bits (223), Expect = 1.067e-17
Identity = 46/146 (31.51%), Postives = 78/146 (53.42%), Query Frame = 1
Query:   40 YRTFIDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVD 477
            Y   ++ +CK+G    A+EL R +     +LD   YS +IDGLCK G L  A+ LF+ +      AD++TYN +I   C  G+ D    L  DM  + ++P+ V F+ L+   ++  +  +  +LL  M +R + P+  T + ++D
Sbjct:  231 YGPVLNVMCKSGQTALAMELLRKMEERNIKLDAVKYSIIIDGLCKDGSLDNAFNLFNEMEIKGFKADIITYNTLIGGFCNAGRWDDGAKLLRDMIKRKISPNVVTFSVLIDSFVKEGKLREADQLLKEMMQRGIAPNTITYNSLID 376          

HSP 7 Score: 77.411 bits (189), Expect = 9.347e-14
Identity = 45/153 (29.41%), Postives = 75/153 (49.02%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVV 474
            G  AD   Y T I G C  G   +  +L R +   K   ++ ++S LID   K G+L+ A +L   + +  +  + +TYN +I   C + ++++A  +   M +KG  PD + FN L+ G  + N     +EL   M  R VI +  T + +V
Sbjct:  293 GFKADIITYNTLIGGFCNAGRWDDGAKLLRDMIKRKISPNVVTFSVLIDSFVKEGKLREADQLLKEMMQRGIAPNTITYNSLIDGFCKENRLEEAIQMVDLMISKGCDPDIMTFNILINGYCKANRIDDGLELFREMSLRGVIANTVTYNTLV 445          
BLAST of FC928840 vs. ExPASy Swiss-Prot
Match: PPR37_ARATH (Pentatricopeptide repeat-containing protein At1g12620 OS=Arabidopsis thaliana GN=At1g12620 PE=2 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 2.220e-23
Identity = 59/155 (38.06%), Postives = 88/155 (56.77%), Query Frame = 1
Query:   19 VAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLL 483
            V  D  +Y+  +DGLC NG   +ALE+F  +   K ELDI  Y+ +I G+C + ++  AW+LF SLP   +  DV TYNIMI  LC  G + +A  LF  ME  G +P+   +N L+   +   + +K  +L+  +       DAST+ +VVD+L
Sbjct:  453 VRPDIVSYKILLDGLCDNGEPEKALEIFEKIEKSKMELDIGIYNIIIHGMCNASKVDDAWDLFCSLPLKGVKPDVKTYNIMIGGLCKKGSLSEADLLFRKMEEDGHSPNGCTYNILIRAHLGEGDATKSAKLIEEIKRCGFSVDASTVKMVVDML 607          

HSP 2 Score: 105.916 bits (263), Expect = 2.454e-22
Identity = 55/153 (35.95%), Postives = 83/153 (54.25%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVV 474
            GV ADT  Y T I G C+ G +  A ELF+ +   +   DI SY  L+DGLC +G  + A E+F  + +  +  D+  YNI+IH +C   K+D A DLF  +  KGV PD   +N ++ G  +    S+   L  +M+E    P+  T +I++
Sbjct:  417 GVVADTVTYNTLIQGFCELGKLEVAKELFQEMVSRRVRPDIVSYKILLDGLCDNGEPEKALEIFEKIEKSKMELDIGIYNIIIHGMCNASKVDDAWDLFCSLPLKGVKPDVKTYNIMIGGLCKKGSLSEADLLFRKMEEDGHSPNGCTYNILI 569          

HSP 3 Score: 93.2041 bits (230), Expect = 1.646e-18
Identity = 46/155 (29.68%), Postives = 84/155 (54.19%), Query Frame = 1
Query:   10 RHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVV 474
            + G++ DT  Y + IDG CK   + +A  +   +    C  +I +++ LI+G CK+  +    ELF  +    ++AD VTYN +I   C  GK++ A +LF +M ++ V PD V++  L+ G   N E  K +E+  ++++  +  D    +I++
Sbjct:  345 QRGISPDTVTYTSLIDGFCKENQLDKANHMLDLMVSKGCGPNIRTFNILINGYCKANLIDDGLELFRKMSLRGVVADTVTYNTLIQGFCELGKLEVAKELFQEMVSRRVRPDIVSYKILLDGLCDNGEPEKALEIFEKIEKSKMELDIGIYNIII 499          

HSP 4 Score: 90.1225 bits (222), Expect = 1.393e-17
Identity = 48/146 (32.88%), Postives = 75/146 (51.37%), Query Frame = 1
Query:   40 YRTFIDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVD 477
            Y   +  +CK+G    A+EL R +   K +LD   YS +IDGLCK G L  A+ LF+ +      AD++ Y  +I   C  G+ D    L  DM  + + PD VAF+ L+   ++  +  +  EL   M +R + PD  T + ++D
Sbjct:  215 YGPVLKVMCKSGQTALAMELLRKMEERKIKLDAVKYSIIIDGLCKDGSLDNAFNLFNEMEIKGFKADIIIYTTLIRGFCYAGRWDDGAKLLRDMIKRKITPDVVAFSALIDCFVKEGKLREAEELHKEMIQRGISPDTVTYTSLID 360          

HSP 5 Score: 85.5001 bits (210), Expect = 3.432e-16
Identity = 47/169 (27.81%), Postives = 85/169 (50.30%), Query Frame = 1
Query:   19 VAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKNEISLNSIPQFK 525
            +  D   Y   IDGLCK+G +  A  LF  + I   + DI  Y+ LI G C +GR     +L   + +  +  DVV ++ +I     +GK+ +A +L  +M  +G++PD V + +L+ G  + N+  K   +L  M  +   P+  T +I+++   K  +  + +  F+
Sbjct:  243 IKLDAVKYSIIIDGLCKDGSLDNAFNLFNEMEIKGFKADIIIYTTLIRGFCYAGRWDDGAKLLRDMIKRKITPDVVAFSALIDCFVKEGKLREAEELHKEMIQRGISPDTVTYTSLIDGFCKENQLDKANHMLDLMVSKGCGPNIRTFNILINGYCKANLIDDGLELFR 411          

HSP 6 Score: 84.7297 bits (208), Expect = 5.855e-16
Identity = 46/146 (31.51%), Postives = 75/146 (51.37%), Query Frame = 1
Query:   52 IDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            ++GLC NG + +A+ L   +     + +  +Y  ++  +CKSG+  +A EL   +    +  D V Y+I+I  LC DG +D A +LF +ME KG   D + + TL+ G           +LL  M +R + PD    S ++D  VK
Sbjct:  184 VNGLCLNGKVSDAVLLIDRMVETGFQPNEVTYGPVLKVMCKSGQTALAMELLRKMEERKIKLDAVKYSIIIDGLCKDGSLDNAFNLFNEMEIKGFKADIIIYTTLIRGFCYAGRWDDGAKLLRDMIKRKITPDVVAFSALIDCFVK 329          

HSP 7 Score: 82.0333 bits (201), Expect = 3.795e-15
Identity = 45/158 (28.48%), Postives = 81/158 (51.27%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            G   +   +   I+G CK   I + LELFR + +     D  +Y+ LI G C+ G+L++A ELF  +    +  D+V+Y I++  LC +G+ +KA ++F  +E   +  D   +N ++ G    ++     +L   +  + V PD  T +I++  L K
Sbjct:  382 GCGPNIRTFNILINGYCKANLIDDGLELFRKMSLRGVVADTVTYNTLIQGFCELGKLEVAKELFQEMVSRRVRPDIVSYKILLDGLCDNGEPEKALEIFEKIEKSKMELDIGIYNIIIHGMCNASKVDDAWDLFCSLPLKGVKPDVKTYNIMIGGLCK 539          

HSP 8 Score: 79.337 bits (194), Expect = 2.460e-14
Identity = 48/153 (31.37%), Postives = 75/153 (49.02%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVV 474
            G  AD   Y T I G C  G   +  +L R +   K   D+ ++S LID   K G+L+ A EL   + +  +  D VTY  +I   C + ++DKA+ +   M +KG  P+   FN L+ G  + N     +EL  +M  R V+ D  T + ++
Sbjct:  277 GFKADIIIYTTLIRGFCYAGRWDDGAKLLRDMIKRKITPDVVAFSALIDCFVKEGKLREAEELHKEMIQRGISPDTVTYTSLIDGFCKENQLDKANHMLDLMVSKGCGPNIRTFNILINGYCKANLIDDGLELFRKMSLRGVVADTVTYNTLI 429          

HSP 9 Score: 74.7146 bits (182), Expect = 6.059e-13
Identity = 48/158 (30.38%), Postives = 72/158 (45.57%), Query Frame = 1
Query:   19 VAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKN 492
            +  D  A+   ID   K G + EA EL + +       D  +Y+ LIDG CK  +L  A  +   +       ++ T+NI+I+  C    +D   +LF  M  +GV  D V +NTL+ G     +     EL   M  R V PD  +  I++D L  N
Sbjct:  313 ITPDVVAFSALIDCFVKEGKLREAEELHKEMIQRGISPDTVTYTSLIDGFCKENQLDKANHMLDLMVSKGCGPNIRTFNILINGYCKANLIDDGLELFRKMSLRGVVADTVTYNTLIQGFCELGKLEVAKELFQEMVSRRVRPDIVSYKILLDGLCDN 470          

HSP 10 Score: 69.3218 bits (168), Expect = 2.545e-11
Identity = 45/159 (28.30%), Postives = 79/159 (49.69%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKN 492
            G+A + +     I+  C+   +  A      +  L  E D  ++S LI+GLC  GR+  A EL   +        ++T N +++ LC +GK+  A  L   M   G  P+ V +  ++    ++ +T+  +ELL +M+ER +  DA   SI++D L K+
Sbjct:  102 GIAHNLYTLSIMINCCCRCRKLSLAFSAMGKIIKLGYEPDTVTFSTLINGLCLEGRVSEALELVDRMVEMGHKPTLITLNALVNGLCLNGKVSDAVLLIDRMVETGFQPNEVTYGPVLKVMCKSGQTALAMELLRKMEERKIKLDAVKYSIIIDGLCKD 260          
BLAST of FC928840 vs. ExPASy Swiss-Prot
Match: PP101_ARATH (Pentatricopeptide repeat-containing protein At1g63330 OS=Arabidopsis thaliana GN=At1g63330 PE=2 SV=2)

HSP 1 Score: 109.383 bits (272), Expect = 2.220e-23
Identity = 56/156 (35.90%), Postives = 91/156 (58.33%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLL 483
            GV  D   Y   +DGLC NG + +ALE+F  ++  + +LDI  Y+ +I+G+CK+G++   W+LF SL    +  +VVTYN MI  LC+   + +A+ L   M+  G  PD   +NTL+   +R+ + +   EL+  M     + DAST+ +V ++L
Sbjct:  390 GVPPDIMTYSILLDGLCNNGKLEKALEVFDYMQKSEIKLDIYIYTTMIEGMCKAGKVDDGWDLFCSLSLKGVKPNVVTYNTMISGLCSKRLLQEAYALLKKMKEDGPLPDSGTYNTLIRAHLRDGDKAASAELIREMRSCRFVGDASTIGLVANML 545          

HSP 2 Score: 87.4261 bits (215), Expect = 9.032e-17
Identity = 45/160 (28.12%), Postives = 80/160 (50.00%), Query Frame = 1
Query:   10 RHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            +  +  D + Y + I+G C +  + +A ++F  +    C  D+ +Y+ LI G CKS R++   ELF  +    L+ D VTY  +I  L  DG  D A  +F  M + GV PD + ++ L+ G   N +  K +E+   M +  +  D    + +++ + K
Sbjct:  283 KRSIDPDIFTYNSLINGFCMHDRLDKAKQMFEFMVSKDCFPDLDTYNTLIKGFCKSKRVEDGTELFREMSHRGLVGDTVTYTTLIQGLFHDGDCDNAQKVFKQMVSDGVPPDIMTYSILLDGLCNNGKLEKALEVFDYMQKSEIKLDIYIYTTMIEGMCK 442          

HSP 3 Score: 86.6557 bits (213), Expect = 1.541e-16
Identity = 48/158 (30.38%), Postives = 84/158 (53.16%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            G   DT  + T I GL  +    EA+ L   +    C+ ++ +Y  +++GLCK G + +A+ L + +    + ADVV +N +I +LC    +D A +LF +ME KG+ P+ V +++L+         S   +LL  M E+ + P+  T + ++D  VK
Sbjct:  110 GYRPDTITFTTLIHGLFLHNKASEAVALVDRMVQRGCQPNLVTYGVVVNGLCKRGDIDLAFNLLNKMEAAKIEADVVIFNTIIDSLCKYRHVDDALNLFKEMETKGIRPNVVTYSSLISCLCSYGRWSDASQLLSDMIEKKINPNLVTFNALIDAFVK 267          

HSP 4 Score: 86.6557 bits (213), Expect = 1.541e-16
Identity = 52/184 (28.26%), Postives = 83/184 (45.11%), Query Frame = 1
Query:   28 DTWAYRTFIDGLCKNGYIVEALELFRTL-----------------------------RILKCEL------DIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVV 474
            D   Y T I G CK+  + +  ELFR +                             ++ K  +      DI +YS L+DGLC +G+L+ A E+F  + +  +  D+  Y  MI  +C  GK+D   DLF  +  KGV P+ V +NT++ G        +   LL +M E   +PD+ T + ++
Sbjct:  324 DLDTYNTLIKGFCKSKRVEDGTELFREMSHRGLVGDTVTYTTLIQGLFHDGDCDNAQKVFKQMVSDGVPPDIMTYSILLDGLCNNGKLEKALEVFDYMQKSEIKLDIYIYTTMIEGMCKAGKVDDGWDLFCSLSLKGVKPNVVTYNTMISGLCSKRLLQEAYALLKKMKEDGPLPDSGTYNTLI 507          

HSP 5 Score: 79.337 bits (194), Expect = 2.460e-14
Identity = 44/159 (27.67%), Postives = 79/159 (49.69%), Query Frame = 1
Query:   19 VAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKNE 495
            + AD   + T ID LCK  ++ +AL LF+ +       ++ +YS LI  LC  GR   A +L   +    +  ++VT+N +I A   +GK  +A  L  DM  + + PD   +N+L+ G   ++   K  ++   M  ++  PD  T + ++    K++
Sbjct:  181 IEADVVIFNTIIDSLCKYRHVDDALNLFKEMETKGIRPNVVTYSSLISCLCSYGRWSDASQLLSDMIEKKINPNLVTFNALIDAFVKEGKFVEAEKLHDDMIKRSIDPDIFTYNSLINGFCMHDRLDKAKQMFEFMVSKDCFPDLDTYNTLIKGFCKSK 339          

HSP 6 Score: 78.1814 bits (191), Expect = 5.480e-14
Identity = 45/156 (28.85%), Postives = 77/156 (49.36%), Query Frame = 1
Query:   10 RHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVD 477
            + G   +   Y   ++GLCK G I  A  L   +   K E D+  ++ +ID LCK   +  A  LF  +    +  +VVTY+ +I  LC+ G+   A  L  DM  K + P+ V FN L+   ++  +  +  +L   M +R++ PD  T + +++
Sbjct:  143 QRGCQPNLVTYGVVVNGLCKRGDIDLAFNLLNKMEAAKIEADVVIFNTIIDSLCKYRHVDDALNLFKEMETKGIRPNVVTYSSLISCLCSYGRWSDASQLLSDMIEKKINPNLVTFNALIDAFVKEGKFVEAEKLHDDMIKRSIDPDIFTYNSLIN 298          

HSP 7 Score: 75.8702 bits (185), Expect = 2.720e-13
Identity = 44/151 (29.14%), Postives = 72/151 (47.68%), Query Frame = 1
Query:   40 YRTFIDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKN 492
            +   ID   K G  VEA +L   +     + DI +Y+ LI+G C   RL  A ++F  +       D+ TYN +I   C   +++   +LF +M  +G+  D V + TL+ G   + +     ++  +M    V PD  T SI++D L  N
Sbjct:  258 FNALIDAFVKEGKFVEAEKLHDDMIKRSIDPDIFTYNSLINGFCMHDRLDKAKQMFEFMVSKDCFPDLDTYNTLIKGFCKSKRVEDGTELFREMSHRGLVGDTVTYTTLIQGLFHDGDCDNAQKVFKQMVSDGVPPDIMTYSILLDGLCNN 408          

HSP 8 Score: 72.4034 bits (176), Expect = 3.007e-12
Identity = 44/170 (25.88%), Postives = 78/170 (45.88%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKNEISLNSIPQFK 525
            G+  +   Y + I  LC  G   +A +L   +   K   ++ +++ LID   K G+   A +L   + +  +  D+ TYN +I+  C   ++DKA  +F  M +K   PD   +NTL+ G  ++       EL   M  R ++ D  T + ++  L  +    N+   FK
Sbjct:  215 GIRPNVVTYSSLISCLCSYGRWSDASQLLSDMIEKKINPNLVTFNALIDAFVKEGKFVEAEKLHDDMIKRSIDPDIFTYNSLINGFCMHDRLDKAKQMFEFMVSKDCFPDLDTYNTLIKGFCKSKRVEDGTELFREMSHRGLVGDTVTYTTLIQGLFHDGDCDNAQKVFK 384          
BLAST of FC928840 vs. ExPASy Swiss-Prot
Match: PPR91_ARATH (Pentatricopeptide repeat-containing protein At1g62670, mitochondrial OS=Arabidopsis thaliana GN=At1g62670 PE=2 SV=2)

HSP 1 Score: 108.612 bits (270), Expect = 3.786e-23
Identity = 55/156 (35.26%), Postives = 89/156 (57.05%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLL 483
            GV  +   Y T +DGLCKNG + +A+ +F  L+  K E  I +Y+ +I+G+CK+G+++  W+LF +L    +  DVV YN MI   C  G  ++A  LF +M+  G  P+   +NTL+   +R+ +     EL+  M       DAST+ +V ++L
Sbjct:  461 GVPPNIMTYNTLLDGLCKNGKLEKAMVVFEYLQRSKMEPTIYTYNIMIEGMCKAGKVEDGWDLFCNLSLKGVKPDVVAYNTMISGFCRKGSKEEADALFKEMKEDGTLPNSGCYNTLIRARLRDGDREASAELIKEMRSCGFAGDASTIGLVTNML 616          

HSP 2 Score: 92.4337 bits (228), Expect = 2.808e-18
Identity = 52/158 (32.91%), Postives = 81/158 (51.27%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            G   +T  + T I GL  +    EA+ L   +    C+ D+ +Y  +++GLCK G   +A+ L + + +G L   V+ YN +I  LC    MD A +LF +ME KG+ P+ V +++L+         S    LL  M ER + PD  T S ++D  VK
Sbjct:  181 GYQPNTVTFNTLIHGLFLHNKASEAMALIDRMVAKGCQPDLVTYGVVVNGLCKRGDTDLAFNLLNKMEQGKLEPGVLIYNTIIDGLCKYKHMDDALNLFKEMETKGIRPNVVTYSSLISCLCNYGRWSDASRLLSDMIERKINPDVFTFSALIDAFVK 338          

HSP 3 Score: 88.1965 bits (217), Expect = 5.295e-17
Identity = 44/150 (29.33%), Postives = 81/150 (54.00%), Query Frame = 1
Query:   40 YRTFIDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            Y + I+G C +  + EA ++F  +    C  D+ +Y+ LI G CK  R++   E+F  + +  L+ + VTYNI+I  L   G  D A ++F +M + GV P+ + +NTL+ G  +N +  K + +   +    + P   T +I+++ + K
Sbjct:  364 YSSLINGFCMHDRLDEAKQMFEFMVSKHCFPDVVTYNTLIKGFCKYKRVEEGMEVFREMSQRGLVGNTVTYNILIQGLFQAGDCDMAQEIFKEMVSDGVPPNIMTYNTLLDGLCKNGKLEKAMVVFEYLQRSKMEPTIYTYNIMIEGMCK 513          

HSP 4 Score: 78.1814 bits (191), Expect = 5.480e-14
Identity = 44/155 (28.39%), Postives = 76/155 (49.03%), Query Frame = 1
Query:   28 DTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKN 492
            D + +   ID   K G +VEA +L+  +     +  I +YS LI+G C   RL  A ++F  +       DVVTYN +I   C   ++++  ++F +M  +G+  + V +N L+ G  +  +     E+   M    V P+  T + ++D L KN
Sbjct:  325 DVFTFSALIDAFVKEGKLVEAEKLYDEMVKRSIDPSIVTYSSLINGFCMHDRLDEAKQMFEFMVSKHCFPDVVTYNTLIKGFCKYKRVEEGMEVFREMSQRGLVGNTVTYNILIQGLFQAGDCDMAQEIFKEMVSDGVPPNIMTYNTLLDGLCKN 479          

HSP 5 Score: 75.485 bits (184), Expect = 3.552e-13
Identity = 41/153 (26.80%), Postives = 77/153 (50.33%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVV 474
            G+  +   Y + I  LC  G   +A  L   +   K   D+ ++S LID   K G+L  A +L+  + +  +   +VTY+ +I+  C   ++D+A  +F  M +K   PD V +NTL+ G  +     + +E+   M +R ++ +  T +I++
Sbjct:  286 GIRPNVVTYSSLISCLCNYGRWSDASRLLSDMIERKINPDVFTFSALIDAFVKEGKLVEAEKLYDEMVKRSIDPSIVTYSSLINGFCMHDRLDEAKQMFEFMVSKHCFPDVVTYNTLIKGFCKYKRVEEGMEVFREMSQRGLVGNTVTYNILI 438          

HSP 6 Score: 75.485 bits (184), Expect = 3.552e-13
Identity = 51/205 (24.88%), Postives = 89/205 (43.41%), Query Frame = 1
Query:   28 DTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKA-----------------------------------HDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKN---EISLNSIPQFKS 528
            D   Y T I G CK   + E +E+FR +       +  +Y+ LI GL ++G   +A E+F  +    +  +++TYN ++  LC +GK++KA                                    DLF ++  KGV PD VA+NT++ G  R     +   L   M E   +P++   + ++   +++   E S   I + +S
Sbjct:  395 DVVTYNTLIKGFCKYKRVEEGMEVFREMSQRGLVGNTVTYNILIQGLFQAGDCDMAQEIFKEMVSDGVPPNIMTYNTLLDGLCKNGKLEKAMVVFEYLQRSKMEPTIYTYNIMIEGMCKAGKVEDGWDLFCNLSLKGVKPDVVAYNTMISGFCRKGSKEEADALFKEMKEDGTLPNSGCYNTLIRARLRDGDREASAELIKEMRS 599          

HSP 7 Score: 74.3294 bits (181), Expect = 7.913e-13
Identity = 40/145 (27.59%), Postives = 74/145 (51.03%), Query Frame = 1
Query:   40 YRTFIDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVV 474
            Y T IDGLCK  ++ +AL LF+ +       ++ +YS LI  LC  GR   A  L   +    +  DV T++ +I A   +GK+ +A  L+ +M  + + P  V +++L+ G   ++   +  ++   M  ++  PD  T + ++
Sbjct:  259 YNTIIDGLCKYKHMDDALNLFKEMETKGIRPNVVTYSSLISCLCNYGRWSDASRLLSDMIERKINPDVFTFSALIDAFVKEGKLVEAEKLYDEMVKRSIDPSIVTYSSLINGFCMHDRLDEAKQMFEFMVSKHCFPDVVTYNTLI 403          

HSP 8 Score: 72.0182 bits (175), Expect = 3.927e-12
Identity = 44/154 (28.57%), Postives = 72/154 (46.75%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVD 477
            G   D   Y   ++GLCK G    A  L   +   K E  +  Y+ +IDGLCK   +  A  LF  +    +  +VVTY+ +I  LC  G+   A  L  DM  + + PD   F+ L+   ++  +  +  +L   M +R++ P   T S +++
Sbjct:  216 GCQPDLVTYGVVVNGLCKRGDTDLAFNLLNKMEQGKLEPGVLIYNTIIDGLCKYKHMDDALNLFKEMETKGIRPNVVTYSSLISCLCNYGRWSDASRLLSDMIERKINPDVFTFSALIDAFVKEGKLVEAEKLYDEMVKRSIDPSIVTYSSLIN 369          
BLAST of FC928840 vs. ExPASy Swiss-Prot
Match: PPR90_ARATH (Pentatricopeptide repeat-containing protein At1g62590 OS=Arabidopsis thaliana GN=At1g62590 PE=2 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 8.434e-23
Identity = 55/156 (35.26%), Postives = 91/156 (58.33%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLL 483
            GV  D   Y   +DGLC NG + +ALE+F  ++  + +LDI  Y+ +I+G+CK+G++   W+LF SL    +  +VVTYN MI  LC+   + +A+ L   M+  G  P+   +NTL+   +R+ + +   EL+  M     + DAST+ +V ++L
Sbjct:  465 GVPPDIMTYSILLDGLCNNGKLEKALEVFDYMQKSEIKLDIYIYTTMIEGMCKAGKVDDGWDLFCSLSLKGVKPNVVTYNTMISGLCSKRLLQEAYALLKKMKEDGPLPNSGTYNTLIRAHLRDGDKAASAELIREMRSCRFVGDASTIGLVANML 620          

HSP 2 Score: 87.0409 bits (214), Expect = 1.180e-16
Identity = 44/160 (27.50%), Postives = 80/160 (50.00%), Query Frame = 1
Query:   10 RHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            +  +  D + Y + ++G C +  + +A ++F  +    C  D+ +Y+ LI G CKS R++   ELF  +    L+ D VTY  +I  L  DG  D A  +F  M + GV PD + ++ L+ G   N +  K +E+   M +  +  D    + +++ + K
Sbjct:  358 KRSIDPDIFTYNSLVNGFCMHDRLDKAKQMFEFMVSKDCFPDVVTYNTLIKGFCKSKRVEDGTELFREMSHRGLVGDTVTYTTLIQGLFHDGDCDNAQKVFKQMVSDGVPPDIMTYSILLDGLCNNGKLEKALEVFDYMQKSEIKLDIYIYTTMIEGMCK 517          

HSP 3 Score: 85.5001 bits (210), Expect = 3.432e-16
Identity = 51/184 (27.72%), Postives = 83/184 (45.11%), Query Frame = 1
Query:   28 DTWAYRTFIDGLCKNGYIVEALELFRTL-----------------------------RILKCEL------DIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVV 474
            D   Y T I G CK+  + +  ELFR +                             ++ K  +      DI +YS L+DGLC +G+L+ A E+F  + +  +  D+  Y  MI  +C  GK+D   DLF  +  KGV P+ V +NT++ G        +   LL +M E   +P++ T + ++
Sbjct:  399 DVVTYNTLIKGFCKSKRVEDGTELFREMSHRGLVGDTVTYTTLIQGLFHDGDCDNAQKVFKQMVSDGVPPDIMTYSILLDGLCNNGKLEKALEVFDYMQKSEIKLDIYIYTTMIEGMCKAGKVDDGWDLFCSLSLKGVKPNVVTYNTMISGLCSKRLLQEAYALLKKMKEDGPLPNSGTYNTLI 582          

HSP 4 Score: 84.3445 bits (207), Expect = 7.646e-16
Identity = 48/158 (30.38%), Postives = 82/158 (51.90%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVK 489
            G   DT  + T I GL  +    EA+ L   +    C+ ++ +Y  +++GLCK G   +A  L + +    + ADVV +N +I +LC    +D A +LF +ME KG+ P+ V +++L+         S   +LL  M E+ + P+  T + ++D  VK
Sbjct:  185 GYRPDTITFTTLIHGLFLHNKASEAVALVDRMVQRGCQPNLVTYGVVVNGLCKRGDTDLALNLLNKMEAAKIEADVVIFNTIIDSLCKYRHVDDALNLFKEMETKGIRPNVVTYSSLISCLCSYGRWSDASQLLSDMIEKKINPNLVTFNALIDAFVK 342          

HSP 5 Score: 80.8777 bits (198), Expect = 8.454e-15
Identity = 45/151 (29.80%), Postives = 74/151 (49.01%), Query Frame = 1
Query:   40 YRTFIDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKN 492
            +   ID   K G  VEA +L+  +     + DI +Y+ L++G C   RL  A ++F  +       DVVTYN +I   C   +++   +LF +M  +G+  D V + TL+ G   + +     ++  +M    V PD  T SI++D L  N
Sbjct:  333 FNALIDAFVKEGKFVEAEKLYDDMIKRSIDPDIFTYNSLVNGFCMHDRLDKAKQMFEFMVSKDCFPDVVTYNTLIKGFCKSKRVEDGTELFREMSHRGLVGDTVTYTTLIQGLFHDGDCDNAQKVFKQMVSDGVPPDIMTYSILLDGLCNN 483          

HSP 6 Score: 80.4925 bits (197), Expect = 1.104e-14
Identity = 44/159 (27.67%), Postives = 80/159 (50.31%), Query Frame = 1
Query:   19 VAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKNE 495
            + AD   + T ID LCK  ++ +AL LF+ +       ++ +YS LI  LC  GR   A +L   +    +  ++VT+N +I A   +GK  +A  L+ DM  + + PD   +N+L+ G   ++   K  ++   M  ++  PD  T + ++    K++
Sbjct:  256 IEADVVIFNTIIDSLCKYRHVDDALNLFKEMETKGIRPNVVTYSSLISCLCSYGRWSDASQLLSDMIEKKINPNLVTFNALIDAFVKEGKFVEAEKLYDDMIKRSIDPDIFTYNSLVNGFCMHDRLDKAKQMFEFMVSKDCFPDVVTYNTLIKGFCKSK 414          

HSP 7 Score: 78.9518 bits (193), Expect = 3.213e-14
Identity = 46/156 (29.49%), Postives = 77/156 (49.36%), Query Frame = 1
Query:   10 RHGVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVD 477
            + G   +   Y   ++GLCK G    AL L   +   K E D+  ++ +ID LCK   +  A  LF  +    +  +VVTY+ +I  LC+ G+   A  L  DM  K + P+ V FN L+   ++  +  +  +L   M +R++ PD  T + +V+
Sbjct:  218 QRGCQPNLVTYGVVVNGLCKRGDTDLALNLLNKMEAAKIEADVVIFNTIIDSLCKYRHVDDALNLFKEMETKGIRPNVVTYSSLISCLCSYGRWSDASQLLSDMIEKKINPNLVTFNALIDAFVKEGKFVEAEKLYDDMIKRSIDPDIFTYNSLVN 373          

HSP 8 Score: 76.2554 bits (186), Expect = 2.082e-13
Identity = 44/170 (25.88%), Postives = 80/170 (47.06%), Query Frame = 1
Query:   16 GVAADTWAYRTFIDGLCKNGYIVEALELFRTLRILKCELDIPSYSCLIDGLCKSGRLKIAWELFHSLPRGVLIADVVTYNIMIHALCADGKMDKAHDLFLDMEAKGVAPDCVAFNTLMLGCIRNNETSKVVELLHRMDERNVIPDASTLSIVVDLLVKNEISLNSIPQFK 525
            G+  +   Y + I  LC  G   +A +L   +   K   ++ +++ LID   K G+   A +L+  + +  +  D+ TYN +++  C   ++DKA  +F  M +K   PD V +NTL+ G  ++       EL   M  R ++ D  T + ++  L  +    N+   FK
Sbjct:  290 GIRPNVVTYSSLISCLCSYGRWSDASQLLSDMIEKKINPNLVTFNALIDAFVKEGKFVEAEKLYDDMIKRSIDPDIFTYNSLVNGFCMHDRLDKAKQMFEFMVSKDCFPDVVTYNTLIKGFCKSKRVEDGTELFREMSHRGLVGDTVTYTTLIQGLFHDGDCDNAQKVFK 459          
The following BLAST results are available for this feature:
BLAST of FC928840 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 136
Match NameE-valueIdentityDescription
PPR38_ARATH5.644e-2737.04Putative pentatricopeptide repeat-containing prote... [more]
PP103_ARATH4.778e-2637.04Pentatricopeptide repeat-containing protein At1g64... [more]
PPR98_ARATH2.008e-2436.54Pentatricopeptide repeat-containing protein At1g63... [more]
PPR99_ARATH1.301e-2335.90Pentatricopeptide repeat-containing protein At1g63... [more]
PPR36_ARATH1.699e-2339.19Pentatricopeptide repeat-containing protein At1g12... [more]
PPR39_ARATH2.220e-2333.72Pentatricopeptide repeat-containing protein At1g12... [more]
PPR37_ARATH2.220e-2338.06Pentatricopeptide repeat-containing protein At1g12... [more]
PP101_ARATH2.220e-2335.90Pentatricopeptide repeat-containing protein At1g63... [more]
PPR91_ARATH3.786e-2335.26Pentatricopeptide repeat-containing protein At1g62... [more]
PPR90_ARATH8.434e-2335.26Pentatricopeptide repeat-containing protein At1g62... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAH3AH06RM1 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH3AH06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC928840 ID=FC928840|Name=FC928840|organism=Citrus clementina|type=EST|length=758bp
GGCACGAGGCGTCATGGCGTGGCAGCTGATACCTGGGCATATAGAACCTT
TATTGATGGGCTCTGCAAGAATGGTTATATTGTAGAGGCACTTGAACTAT
TTCGTACTTTGAGAATTCTCAAGTGTGAACTTGATATTCCATCCTACAGC
TGCCTCATTGATGGATTATGTAAATCCGGCAGACTCAAAATTGCATGGGA
ACTATTTCATAGTTTGCCTCGTGGAGTCCTAATAGCAGATGTTGTAACAT
ATAACATCATGATCCATGCGCTTTGTGCTGATGGAAAAATGGACAAGGCA
CATGATTTGTTTCTTGATATGGAAGCAAAAGGTGTAGCACCCGATTGTGT
CGCATTTAACACGCTGATGCTAGGTTGCATCCGCAATAATGAGACATCAA
AAGTTGTTGAACTCCTTCACAGAATGGATGAGAGAAATGTGATACCAGAT
GCATCTACACTTTCAATTGTTGTGGACTTACTTGTAAAGAATGAAATTAG
CTTAAACTCCATTCCACAATTCAAGAGTCAAAGGTAAGTGAGTTTAATAT
TGATTTAGTCACATGTTTCTTCTGCCTGAAAACCCGATCTGGAGGATCCC
ATTCTTATTAACACGTGTAAAGGAGTGTTGTCTAATGTTGGCATGTTCCT
AGGTTCTGTCCATGGATTCTGTTTGCAGACATGGCTAACTTCTTGTCCAA
CAGATAAGTTTTAAAGTCTTTCAACTTTATGTTGTAAAATAACATTTTCA
TTATTCAA
back to top