FC928842

Overview
NameFC928842
Unique NameFC928842
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length831
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10306 contig Ccv1_Contig10306:11..841. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC928842 vs. ExPASy Swiss-Prot
Match: LGT_CITUN (Limonoid UDP-glucosyltransferase OS=Citrus unshiu PE=2 SV=1)

HSP 1 Score: 495.352 bits (1274), Expect = 1.681e-139
Identity = 239/254 (94.09%), Postives = 241/254 (94.88%), Query Frame = 1
Query:   70 MGTESLVHVLLVSFPGHGHVNPLLRLGRLLASKGFFLTLTTPESFGKQMRKAGNFTYEPTPVGDGFIRXXXXXXXXXXXXPRRGDLDQYMAQLELIGKQVIPKIIRKSAEEYRPVSCLINNPFIPWVSDVAESLGLPSAMLWVQSCACFAAYYHYFHGLVPFPSEKEPEIDVQLPCMPLLKHDEVPSFLHPSTPYPFLRRAILGQYENLGKPFCILLDTFYELEKEIIDYMAKICPIKPVGPLFKNPKAPTLTV 831
            MGTESLVHVLLVSFPGHGHVNPLLRLGRLLASKGFFLTLTTPESFGKQMRKAGNFTYEPTPVGDGFIR            PRR DLDQYMAQLELIGKQVIPKII+KSAEEYRPVSCLINNPFIPWVSDVAESLGLPSAMLWVQSCACFAAYYHYFHGLVPFPSEKEPEIDVQLPCMPLLKHDE+PSFLHPSTPYPFLRRAILGQYENLGKPFCILLDTFYELEKEIIDYMAKICPIKPVGPLFKNPKAPTLTV
Sbjct:    1 MGTESLVHVLLVSFPGHGHVNPLLRLGRLLASKGFFLTLTTPESFGKQMRKAGNFTYEPTPVGDGFIRFEFFEDGWDEDDPRREDLDQYMAQLELIGKQVIPKIIKKSAEEYRPVSCLINNPFIPWVSDVAESLGLPSAMLWVQSCACFAAYYHYFHGLVPFPSEKEPEIDVQLPCMPLLKHDEMPSFLHPSTPYPFLRRAILGQYENLGKPFCILLDTFYELEKEIIDYMAKICPIKPVGPLFKNPKAPTLTV 254          
BLAST of FC928842 vs. ExPASy Swiss-Prot
Match: Y1567_ARATH (Uncharacterized UDP-glucosyltransferase At1g05670 OS=Arabidopsis thaliana GN=At1g05670 PE=2 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 1.202e-28
Identity = 71/236 (30.08%), Postives = 118/236 (50.00%), Query Frame = 1
Query:   91 HVLLVSFPGHGHVNPLLRLGRLLASKGFFLTLTTPESFGKQMRKAGNFTYEPTPVGDGFIRXXXXXXXXXXXXPRRGDLDQYMAQLELIGKQVIPKIIRKSAEEYRPVSCLINNPFIPWVSDVAESLGLPSAMLWVQSCACFAAYYHYFHGLVPFPSEKEPEIDV-QLPCMPLLKHDEVPSFLHPSTPYPFLRRAILGQYENLGKPFCILLDTFYELEKEIIDYMAKICPIKPVGP 795
            HV+++ FP  GH+ P+ +  + LASK   +TL           K  + T    P+ +GF               R  DLD+YM ++E   K  +PK+I        P   L+ +  +PW+ DVA S GL  A+ + Q     A YYH F G    PS K     +   P +P+L  +++PSFL  S+ YP++ R ++ Q  N+ +   +L +TF +LE++++ ++  + P+  +GP
Sbjct:    6 HVIVLPFPAQGHITPMSQFCKRLASKSLKITLVLVSDKPSPPYKTEHDTITVVPISNGF----------QEGQERSEDLDEYMERVESSIKNRLPKLIEDMKLSGNPPRALVYDSTMPWLLDVAHSYGLSGAVFFTQPWLVSAIYYHVFKGSFSVPSTKYGHSTLASFPSLPILNANDLPSFLCESSSYPYILRTVIDQLSNIDRVDIVLCNTFDKLEEKLLKWIKSVWPVLNIGP 231          
BLAST of FC928842 vs. ExPASy Swiss-Prot
Match: UGAGT_ARATH (Anthocyanin 5-O-glucosyltransferase OS=Arabidopsis thaliana GN=UGT75C1 PE=2 SV=2)

HSP 1 Score: 102.834 bits (255), Expect = 2.429e-21
Identity = 76/263 (28.90%), Postives = 122/263 (46.39%), Query Frame = 1
Query:   67 IMGTESLVHVLLVSFPGHGHVNPLLRLGRLLASKGFFLTLTTPESFGKQM-----RKAGNFTYEPTPVGDGFIRXXXXXXXXXXXXPRRGDLDQYMAQLELIGKQVIPKIIRKSAE---EYRPVSCLINNPFIPWVSDVAESLGLPSAMLWVQSCACFAAYYHYFHGLVPFPSEKEPEIDVQLPCMPLLKHDEVPSFLHPSTPYP---FLRRAILGQYENLGKPFCILLDTFYELEKEIIDYMAKICPIKPVGPLFKNPKAPT 822
            + G+    H LLV+FP  GH+NP L+L   L   G  +T +T  S  ++M      K  +F +      DG                   D   YM++L+  G   +  II+ + +   E  P++ +I +  +PWVS VA    LP+ +LW++       YY+YF+       + EP   ++LP +PL+   ++PSFL PS   P      R  +   E    P  IL++TF  LE + +  + K+  I P+GPL  + +  T
Sbjct:    5 VNGSHRRPHYLLVTFPAQGHINPALQLANRLIHHGATVTYSTAVSAHRRMGEPPSTKGLSFAWFTDGFDDGLKSFE--------------DQKIYMSELKRCGSNALRDIIKANLDATTETEPITGVIYSVLVPWVSTVAREFHLPTTLLWIEPATVLDIYYYYFNTSYKHLFDVEP---IKLPKLPLITTGDLPSFLQPSKALPSALVTLREHIEALETESNP-KILVNTFSALEHDALTSVEKLKMI-PIGPLVSSSEGKT 248          
BLAST of FC928842 vs. ExPASy Swiss-Prot
Match: IABG_MAIZE (Indole-3-acetate beta-glucosyltransferase OS=Zea mays GN=IAGLU PE=1 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 9.228e-21
Identity = 65/255 (25.49%), Postives = 111/255 (43.53%), Query Frame = 1
Query:   91 HVLLVSFPGHGHVNPLLRLGRLLASKGFFLTLTTPESFGKQMRKAGNFTYEPTPV---GDGFIRXXXXXXXXXXXXPRRGDLDQYMAQLELIGKQVIPKIIRKSAEEYRPVSCLINNPFIPWVSDVAESLGLPSAMLWVQSCACFAAYYHYFHGLVPFPSEKEPE----------IDVQLPCMPLLKHDEVPSFLHPSTPYPFLRRAILGQYENLGKPFCILLDTFYELEKEIIDYMAKICPIKPVGPLFKNPKA 816
            HVL+V FPG GH+NP+++  + LASKG   TL T     + +++  +    P  V    DG                    + +Y+ +        +  ++   A      +C++ + +  WV  VA  +GLP+     QSCA  A YYH+  G +  P     +          +      +P ++  E+PSF+    PYP +    + Q+ + GK   +L ++F ELE E++  + K    + +GP    P A
Sbjct:    4 HVLVVPFPGQGHMNPMVQFAKRLASKGVATTLVTT----RFIQRTADVDAHPAMVEAISDGH---------DEGGFASAAGVAEYLEKQAAAASASLASLVEARASSADAFTCVVYDSYEDWVLPVARRMGLPAVPFSTQSCAVSAVYYHFSQGRLAVPPGAAADGSDGGAGAAALSEAFLGLPEMERSELPSFVFDHGPYPTIAMQAIKQFAHAGKDDWVLFNSFEELETEVLAGLTKYLKARAIGPCVPLPTA 245          
BLAST of FC928842 vs. ExPASy Swiss-Prot
Match: COGT2_ARATH (Cytokinin-O-glucosyltransferase 2 OS=Arabidopsis thaliana GN=UGT85A1 PE=1 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 5.982e-20
Identity = 68/265 (25.66%), Postives = 123/265 (46.42%), Query Frame = 1
Query:   61 SRIMGTESLVHVLLVSFPGHGHVNPLLRLGRLLASKGFFLT-LTTPESFGKQMRKAGNFTYEPTP------VGDGFIRXXXXXXXXXXXXPRRGDLDQYMAQLELIGKQVIPKIIRKSAEEYRPVSCLINNPFIPWVSDVAESLGLPSAMLWVQSCACFAAYYHYF----HGLVPFPSEK-------EPEIDVQLPCMPLLKHDEVPSFLHPSTPYPFLRRAILGQYENLGKPFCILLDTFYELEKEIIDYMAKIC-PIKPVGPL 798
            S+I+      HV+ V +P  GH+NP++R+ +LL ++GF++T + T  +  + +R  G+   +  P      + DG                     +  M       ++++ +I   + +   PVSC++++  + +  DVAE LG+P  + W  S   F AY H++     GL P   E        E  +   +P M  +K  ++PSF+  + P   +    L + E   +   I+L+TF +LE +++  M  I  P+  VGPL
Sbjct:    3 SQIIHNSQKPHVVCVPYPAQGHINPMMRVAKLLHARGFYVTFVNTVYNHNRFLRSRGSNALDGLPSFRFESIADGLPETDMDATQDITAL-----CESTMKNCLAPFRELLQRI--NAGDNVPPVSCIVSDGCMSFTLDVAEELGVPEVLFWTTSGCAFLAYLHFYLFIEKGLCPLKDESYLTKEYLEDTVIDFIPTMKNVKLKDIPSFIRTTNPDDVMISFALRETERAKRASAIILNTFDDLEHDVVHAMQSILPPVYSVGPL 260          
BLAST of FC928842 vs. ExPASy Swiss-Prot
Match: HMNGT_SORBI (Cyanohydrin beta-glucosyltransferase OS=Sorghum bicolor GN=UGT85B1 PE=1 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 3.877e-19
Identity = 71/260 (27.31%), Postives = 114/260 (43.85%), Query Frame = 1
Query:   91 HVLLVSFPGHGHVNPLLRLGRLLASKGFFLTLT-TPESFGKQMRKAGNFTYEPTPVGDGFIRXXXXXXXXXXXXP-----------RRGDLDQYMAQLELIGKQVIPKIIRKSAEEYRPVSCLINNPFIPWVSDVAESLGLPSAMLWVQSCACFAAYYHY----FHGLVPFPSEK----EPEIDVQLPCMPLLKH---DEVPSFLHPSTPYPFLRRAILGQYENLGKPFCILLDTFYELEKEIIDYMAKIC-PIKPVGPL 798
            HV+LV FPG GHV PL++L RLL ++G  +T   T  ++ + +R  G     P        R            P           R+  L  + A L  +G++V         ++  PV+C++ +  + + +  A   G+P    +  S      Y HY      GLVPF        +  +D  L  +P + H    ++P+F   + P   +  A L Q E+      ++L+T YELEK+++D +A    PI  VGPL
Sbjct:   12 HVVLVPFPGQGHVAPLMQLARLLHARGARVTFVYTQYNYRRLLRAKGEAAVRPPATSSARFRIEVIDDGLSLSVPQNDVGGLVDSLRKNCLHPFRALLRRLGQEV-------EGQDAPPVTCVVGDVVMTFAAAAAREAGIPEVQFFTASACGLLGYLHYGELVERGLVPFRDASLLADDDYLDTPLEWVPGMSHMRLRDMPTFCRTTDPDDVMVSATLQQMESAAGSKALILNTLYELEKDVVDALAAFFPPIYTVGPL 264          
BLAST of FC928842 vs. ExPASy Swiss-Prot
Match: HTGT_ARATH (N-hydroxythioamide S-beta-glucosyltransferase OS=Arabidopsis thaliana GN=UGT74B1 PE=1 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 1.427e-13
Identity = 55/220 (25.00%), Postives = 101/220 (45.91%), Query Frame = 1
Query:   91 HVLLVSFPGHGHVNPLLRLGRLLASKGFFLTLTTPESFGKQMRKAGNFTYEPTPVGDGFIRXXXXXXXXXXXXPRRGDLDQYMAQLELIGKQVIPKIIRKSAEEYRPVSCLINNPFIPWVSDVAESLGLPSAMLWVQSCACFAAYYHYFHGLVPFPSEKEPEIDVQLPCMPLLKHDEVPSFL--HPSTPYPFLRRAILGQYENLGKPFCILLDTFYELEK 744
            HV+++ +P  GH+NP+++  + L SK   +T+ T  ++        + + EP   G  FI                  +D Y    +L G + +  +I K      P+ CLI + F+PW  +VA S+ L +A  +  +    +    + +G  P P++       ++  +P L +DE+PSF+  H  T +P   R +L Q+ N      + ++ F  LE+
Sbjct:   11 HVVILPYPVQGHLNPMVQFAKRLVSKNVKVTIATT-TYTASSITTPSLSVEPISDGFDFIPIGIPGF----------SVDTYSESFKLNGSETLTLLIEKFKSTDSPIDCLIYDSFLPWGLEVARSMELSAASFFTNNLTVCSVLRKFSNGDFPLPADPN-SAPFRIRGLPSLSYDELPSFVGRHWLT-HPEHGRVLLNQFPNHENADWLFVNGFEGLEE 217          
BLAST of FC928842 vs. ExPASy Swiss-Prot
Match: IABG1_ARATH (Indole-3-acetate beta-glucosyltransferase 1 OS=Arabidopsis thaliana GN=UGT75B1 PE=1 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 1.864e-13
Identity = 75/244 (30.74%), Postives = 101/244 (41.39%), Query Frame = 1
Query:   91 HVLLVSFPGHGHVNPLLRLGRLLASK-GFFLTLTTPES-FGKQM----RKAGNFTYEPTPVGDGFIRXXXXXXXXXXXXPRRGDLDQYMAQLELIGKQVIPKIIRKSAEEYRPVSCLINNPFIPWVSDVAESLGLPSAMLWVQSCACFAAYYHYFHGLVPFPSEKEPEIDVQLPCMPLLKHDEVPSFLHPSTPYPFLRRAILGQYENLGKPF--CILLDTFYELEKEIIDYMAKICPIKPVGPL 798
            H LLV+FP  GHVNP LR  R L  + G  +T  T  S F   M     K  N ++      DGF                  D  +    L++ G + +   I  +     PV+CLI    + W   VA    LPSA+LW+Q    F  YY +F G          +   +LP +  L+  ++PSFL PS        A     E L K     IL++TF  LE E +     I  +  VGPL
Sbjct:    5 HFLLVTFPAQGHVNPSLRFARRLIKRTGARVTFVTCVSVFHNSMIANHNKVENLSF--LTFSDGF---------DDGGISTYEDRQKRSVNLKVNGDKALSDFIEATKNGDSPVTCLIYTILLNWAPKVARRFQLPSALLWIQPALVFNIYYTHFMG---------NKSVFELPNLSSLEIRDLPSFLTPSNTNKGAYDAFQEMMEFLIKETKPKILINTFDSLEPEALTAFPNI-DMVAVGPL 227          
BLAST of FC928842 vs. ExPASy Swiss-Prot
Match: IABG2_ARATH (Indole-3-acetate beta-glucosyltransferase 2 OS=Arabidopsis thaliana GN=UGT75B2 PE=2 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 5.423e-13
Identity = 73/249 (29.32%), Postives = 98/249 (39.36%), Query Frame = 1
Query:   91 HVLLVSFPGHGHVNPLLRLG-RLLASKGFFLTLTT-----PESFGKQMRKAGNFTYEPTPVGDGFIRXXXXXXXXXXXXPRRGDLDQYMAQLELIGKQVIPKIIRKSAEEYRPVSCLINNPFIPWVSDVAESLGLPSAMLWVQSCACFAAYYHYFHGLVPFPSEKEPEIDVQLPCMPLLKHDEVPSFLHPSTPYPFLRRAILGQYENL-------GKPFCILLDTFYELEKEIIDYMAKICPIKPVGPL 798
            H LLV+FP  GHVNP LR   RL+ + G  +T  T       S         N ++      DGF                  D+   +   E  G + +   I  +     PVSCLI      WV  VA    LPS  LW+Q    F  YY+Y  G              + P +P L+  ++PSFL PS       +A    Y+ L         P  IL++TF  LE E +  +  I  +  VGPL
Sbjct:    5 HFLLVTFPAQGHVNPSLRFARRLIKTTGARVTFATCLSVIHRSMIPNHNNVENLSF--LTFSDGF---------DDGVISNTDDVQNRLVHFERNGDKALSDFIEANQNGDSPVSCLIYTILPNWVPKVARRFHLPSVHLWIQPAFAFDIYYNYSTG---------NNSVFEFPNLPSLEIRDLPSFLSPSN----TNKAAQAVYQELMDFLKEESNP-KILVNTFDSLEPEFLTAIPNI-EMVAVGPL 227          
The following BLAST results are available for this feature:
BLAST of FC928842 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 9
Match NameE-valueIdentityDescription
LGT_CITUN1.681e-13994.09Limonoid UDP-glucosyltransferase OS=Citrus unshiu ... [more]
Y1567_ARATH1.202e-2830.08Uncharacterized UDP-glucosyltransferase At1g05670 ... [more]
UGAGT_ARATH2.429e-2128.90Anthocyanin 5-O-glucosyltransferase OS=Arabidopsis... [more]
IABG_MAIZE9.228e-2125.49Indole-3-acetate beta-glucosyltransferase OS=Zea m... [more]
COGT2_ARATH5.982e-2025.66Cytokinin-O-glucosyltransferase 2 OS=Arabidopsis t... [more]
HMNGT_SORBI3.877e-1927.31Cyanohydrin beta-glucosyltransferase OS=Sorghum bi... [more]
HTGT_ARATH1.427e-1325.00N-hydroxythioamide S-beta-glucosyltransferase OS=A... [more]
IABG1_ARATH1.864e-1330.74Indole-3-acetate beta-glucosyltransferase 1 OS=Ara... [more]
IABG2_ARATH5.423e-1329.32Indole-3-acetate beta-glucosyltransferase 2 OS=Ara... [more]
back to top
Libraries
Library NameType
PhII-IIIV1cdna_library
Properties
Property NameValue
Genbank descriptionKN0AAH3AH08RM1 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH3AH08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC928842 ID=FC928842|Name=FC928842|organism=Citrus clementina|type=EST|length=831bp
TAGCTCGCCAAGCCCATCTGTCATTTAAATTGCTAGCTAGCCAATTTTAG
AACAAATTATTCGAGAATAATGGGAACTGAATCCCTTGTTCACGTCTTAC
TAGTTTCATTCCCCGGCCATGGCCACGTAAACCCGCTTCTGAGGCTCGGC
AGACTCCTTGCTTCAAAGGGTTTCTTTCTCACCTTGACCACACCTGAAAG
CTTTGGCAAACAAATGAGAAAAGCGGGTAACTTCACCTACGAGCCTACTC
CAGTTGGCGACGGCTTCATTCGCTTCGAATTCTTCGAGGATGGATGGGAC
GAAGACGATCCAAGACGCGGAGATCTTGACCAATACATGGCTCAACTTGA
GCTTATTGGCAAACAAGTGATTCCAAAAATAATCAGGAAAAGCGCTGAAG
AATATCGCCCCGTTTCTTGCCTGATCAATAACCCATTTATCCCTTGGGTT
TCTGATGTTGCTGAATCCCTAGGGCTTCCGTCTGCTATGCTTTGGGTTCA
ATCTTGTGCTTGTTTTGCTGCTTATTACCATTACTTCCACGGTTTGGTTC
CATTTCCTAGTGAAAAGGAACCCGAAATTGATGTTCAGTTGCCGTGCATG
CCACTACTGAAGCATGATGAAGTGCCTAGCTTCTTGCATCCGTCAACTCC
TTATCCTTTCTTGAGAAGAGCTATTTTGGGGCAGTACGAAAATCTTGGCA
AGCCGTTTTGCATATTGTTGGACACTTTCTATGAGCTTGAGAAAGAGATT
ATCGATTACATGGCAAAAATCTGCCCTATTAAACCCGTCGGCCCTCTGTT
CAAAAACCCTAAAGCTCCCACCTTAACCGTC
back to top