FC928843

Overview
NameFC928843
Unique NameFC928843
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length820
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15408 contig Ccv1_Contig15408:42..861. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC928843 vs. ExPASy Swiss-Prot
Match: MSBP2_ARATH (Membrane steroid-binding protein 2 OS=Arabidopsis thaliana GN=MSBP2 PE=1 SV=1)

HSP 1 Score: 278.485 bits (711), Expect = 3.150e-74
Identity = 157/243 (64.61%), Postives = 174/243 (71.60%), Query Frame = 1
Query:   79 MALQLWETLKEAITAYTGLSPAAFFTVVALLWAIYYVLSGMFGSSDNHHQQRSREYEEQMEPLPPPVQLGEITEEELKQYDGSDSKKPLLMAIKSQIYDVSQSRMFYGPGGPYALFAGKDASRALAKMSFEEKDLTGDISGLGPFELEALQDWEYKFMSKYVKVGSIKSTVPVTDGASSGESTEPK----EGVVDTPAESKGVVDTPAETKEVDIAKPAEYGPSETAAAGPEATPSSDDTKKE 795
            M  Q+WETLKE ITAYTGLSPAAFFTV+AL +A+Y V+SG F S + H + RS E + Q EPLPPPVQLGEITEEELK YDGSDSKKPLLMAIK QIYDVSQSRMFYGPGGPYALFAGKDASRALAKMSFE++DLTGDISGLG FELEALQDWEYKFMSKYVKVG+I+      +G  S E +E K    EG+     E    + T  ET      K AE    +  A         DD  KE
Sbjct:    1 MVQQIWETLKETITAYTGLSPAAFFTVLALAFAVYQVVSGFFVSPEVH-RPRSLEVQPQSEPLPPPVQLGEITEEELKLYDGSDSKKPLLMAIKGQIYDVSQSRMFYGPGGPYALFAGKDASRALAKMSFEDQDLTGDISGLGAFELEALQDWEYKFMSKYVKVGTIQK--KDGEGKESSEPSEAKTASAEGLSTNTGEEASAI-THDETSRSTGEKIAETTEKKDVAT------DDDDAAKE 233          
BLAST of FC928843 vs. ExPASy Swiss-Prot
Match: MSBP1_ARATH (Membrane steroid-binding protein 1 OS=Arabidopsis thaliana GN=MSBP1 PE=1 SV=2)

HSP 1 Score: 268.47 bits (685), Expect = 3.259e-71
Identity = 146/216 (67.59%), Postives = 163/216 (75.46%), Query Frame = 1
Query:   79 MALQLWETLKEAITAYTGLSPAAFFTVVALLWAIYYVLSGMFGS---SDNHHQQRSREYEEQMEPLPPPVQLGEITEEELKQYDGSDSKKPLLMAIKSQIYDVSQSRMFYGPGGPYALFAGKDASRALAKMSFEEKDLTGDISGLGPFELEALQDWEYKFMSKYVKVGSIKSTVPVTDGASSGESTEPKE---GVVDTPAESKGVV----DTPAET 696
            MAL+LW+TLKEAI AYTGLSP  FFT +AL +AIY V+SG F S     N HQ+     +E+  P+P PVQ+GEITEEELKQYDGSD +KPLLMAIK QIYDV+QSRMFYGPGGPYALFAGKDASRALAKMSFEEKDLT D+SGLGPFEL+ALQDWEYKFMSKY KVG++K      + AS  E TE  E    V  TP   K VV    D PAET
Sbjct:    1 MALELWQTLKEAIHAYTGLSPVVFFTALALAFAIYQVISGWFASPFDDVNRHQRARSLAQEEEPPIPQPVQVGEITEEELKQYDGSDPQKPLLMAIKHQIYDVTQSRMFYGPGGPYALFAGKDASRALAKMSFEEKDLTWDVSGLGPFELDALQDWEYKFMSKYAKVGTVKVAGSEPETASVSEPTENVEQDAHVTTTP--GKTVVDKSDDAPAET 214          
BLAST of FC928843 vs. ExPASy Swiss-Prot
Match: SBP3_ARATH (Probable steroid-binding protein 3 OS=Arabidopsis thaliana GN=MP3 PE=1 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 4.317e-23
Identity = 50/99 (50.51%), Postives = 69/99 (69.70%), Query Frame = 1
Query:  289 EITEEELKQYDGSDSKKPLLMAIKSQIYDVSQSRMFYGPGGPYALFAGKDASRALAKMSFEEKDLTGDISGLGPFELEALQDWEYKFMSKYVKVGSIKS 585
            E T E+L QY+G+D  KP+ +AIK +++DV+  + FYG GG Y++FAGKDASRAL KMS  E+D++  + GL   E+  L DWE KF +KY  VG + S
Sbjct:    2 EFTAEQLSQYNGTDESKPIYVAIKGRVFDVTTGKSFYGSGGDYSMFAGKDASRALGKMSKNEEDVSPSLEGLTEKEINTLNDWETKFEAKYPVVGRVVS 100          
BLAST of FC928843 vs. ExPASy Swiss-Prot
Match: NENF_RAT (Neudesin OS=Rattus norvegicus GN=Nenf PE=2 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 2.895e-19
Identity = 52/114 (45.61%), Postives = 71/114 (62.28%), Query Frame = 1
Query:  271 PPVQLGEITEEELKQYDGSDSKKPLLMAIKSQIYDVSQSRMFYGPGGPYALFAGKDASRALAKMSFEEKDLTGDISGLGPFELEALQD-WEYKFMSKYVKVGSIKSTVPVTDGA 609
            PPV+L   TEEEL +Y G +  +P+ +A+K  ++DV+  + FYG G PY   AGKD+SR +AKMS +  DLT DISGL   ELEAL D +   + +KY  VG     +   DG+
Sbjct:   41 PPVRL--FTEEELARYSGEEEDQPIYLAVKGVVFDVTSGKEFYGRGAPYNALAGKDSSRGVAKMSLDPADLTHDISGLTAKELEALDDIFSKVYKAKYPIVGYTARRILNEDGS 152          
BLAST of FC928843 vs. ExPASy Swiss-Prot
Match: NENF_MOUSE (Neudesin OS=Mus musculus GN=Nenf PE=1 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 3.201e-18
Identity = 50/114 (43.86%), Postives = 70/114 (61.40%), Query Frame = 1
Query:  271 PPVQLGEITEEELKQYDGSDSKKPLLMAIKSQIYDVSQSRMFYGPGGPYALFAGKDASRALAKMSFEEKDLTGDISGLGPFELEALQD-WEYKFMSKYVKVGSIKSTVPVTDGA 609
            PPV+L   TEEEL +Y G +  +P+ +A+K  ++DV+  + FYG G PY   AGKD+SR +AKMS +  DLT D +GL   ELEAL D +   + +KY  VG     +   DG+
Sbjct:   41 PPVRL--FTEEELARYGGEEEDQPIYLAVKGVVFDVTSGKEFYGRGAPYNALAGKDSSRGVAKMSLDPADLTHDTTGLTAKELEALDDVFSKVYKAKYPIVGYTARRILNEDGS 152          
BLAST of FC928843 vs. ExPASy Swiss-Prot
Match: PGRC1_RAT (Membrane-associated progesterone receptor component 1 OS=Rattus norvegicus GN=Pgrmc1 PE=1 SV=3)

HSP 1 Score: 89.7373 bits (221), Expect = 2.075e-17
Identity = 48/111 (43.24%), Postives = 69/111 (62.16%), Query Frame = 1
Query:  259 EPLP-PPVQLGEITEEELKQYDGSDSKKPLLMAIKSQIYDVSQSRMFYGPGGPYALFAGKDASRALAKMSFEE---KDLTGDISGLGPFELEALQDWEYKFMSKYVKVGSI 579
            EP P P ++  + T  EL++YDG    + +LMAI  +++DV++ R FYGP GPY +FAG+DASR LA    ++   KD   D+S L P + E L DW+ +F  KY  VG +
Sbjct:   61 EPPPLPRLKPRDFTPAELRRYDGVQDPR-ILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASRGLATFCLDKEALKDEYDDLSDLTPAQQETLNDWDSQFTFKYHHVGKL 170          
BLAST of FC928843 vs. ExPASy Swiss-Prot
Match: PGRC1_PIG (Membrane-associated progesterone receptor component 1 OS=Sus scrofa GN=PGRMC1 PE=1 SV=3)

HSP 1 Score: 89.3521 bits (220), Expect = 2.710e-17
Identity = 50/151 (33.11%), Postives = 82/151 (54.30%), Query Frame = 1
Query:  136 SPAAFFTVVALLWAIYYVLSGMFGSSDNHHQQRSREYEEQMEPLPPPVQLGEITEEELKQYDGSDSKKPLLMAIKSQIYDVSQSRMFYGPGGPYALFAGKDASRALAKMSFEE---KDLTGDISGLGPFELEALQDWEYKFMSKYVKVGSI 579
            SP     +   ++ +Y ++ G         Q  + + ++   P  P ++  + T  EL+++DG    + +LMAI  +++DV++ R FYGP GPY +FAG+DASR LA    ++   KD   D+S L P + E L DW+ +F  KY  VG +
Sbjct:   28 SPLNLLLLGLCIFLLYKIVRG--------DQPAASDSDDDEPPPLPRLKRRDFTPAELRRFDGVQDPR-ILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASRGLATFCLDKEALKDEYDDLSDLTPAQQETLNDWDSQFTFKYHHVGKL 169          
BLAST of FC928843 vs. ExPASy Swiss-Prot
Match: PGRC1_BOVIN (Membrane-associated progesterone receptor component 1 OS=Bos taurus GN=PGRMC1 PE=2 SV=3)

HSP 1 Score: 89.3521 bits (220), Expect = 2.710e-17
Identity = 50/151 (33.11%), Postives = 82/151 (54.30%), Query Frame = 1
Query:  136 SPAAFFTVVALLWAIYYVLSGMFGSSDNHHQQRSREYEEQMEPLPPPVQLGEITEEELKQYDGSDSKKPLLMAIKSQIYDVSQSRMFYGPGGPYALFAGKDASRALAKMSFEE---KDLTGDISGLGPFELEALQDWEYKFMSKYVKVGSI 579
            SP     +   ++ +Y ++ G         Q  + + ++   P  P ++  + T  EL+++DG    + +LMAI  +++DV++ R FYGP GPY +FAG+DASR LA    ++   KD   D+S L P + E L DW+ +F  KY  VG +
Sbjct:   28 SPLNLLLLGLCIFLLYKIVRG--------DQPAASDSDDDEPPPLPRLKRRDFTPAELRRFDGVQDPR-ILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASRGLATFCLDKEALKDEYDDLSDLTPAQQETLSDWDSQFTFKYHHVGKL 169          
BLAST of FC928843 vs. ExPASy Swiss-Prot
Match: NENF_BOVIN (Neudesin OS=Bos taurus GN=NENF PE=2 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 2.710e-17
Identity = 48/114 (42.11%), Postives = 69/114 (60.53%), Query Frame = 1
Query:  271 PPVQLGEITEEELKQYDGSDSKKPLLMAIKSQIYDVSQSRMFYGPGGPYALFAGKDASRALAKMSFEEKDLTGDISGLGPFELEALQD-WEYKFMSKYVKVGSIKSTVPVTDGA 609
            PPV+L   TEEEL +Y G +  +P+ MA+K  ++DV+  + FYG G PY    GKD++R +AKMS +  DLT D +GL   ELE+L D +   + +KY  VG     +   DG+
Sbjct:   39 PPVRL--FTEEELARYGGEEEDQPIYMAVKGVVFDVTSGKEFYGRGAPYNALTGKDSTRGVAKMSLDPADLTHDTTGLTAEELESLDDVFTRVYKAKYPIVGYTARRILNEDGS 150          
BLAST of FC928843 vs. ExPASy Swiss-Prot
Match: PGRC1_MOUSE (Membrane-associated progesterone receptor component 1 OS=Mus musculus GN=Pgrmc1 PE=1 SV=4)

HSP 1 Score: 88.5817 bits (218), Expect = 4.623e-17
Identity = 47/111 (42.34%), Postives = 69/111 (62.16%), Query Frame = 1
Query:  259 EPLP-PPVQLGEITEEELKQYDGSDSKKPLLMAIKSQIYDVSQSRMFYGPGGPYALFAGKDASRALAKMSFEE---KDLTGDISGLGPFELEALQDWEYKFMSKYVKVGSI 579
            EP P P ++  + T  EL+++DG    + +LMAI  +++DV++ R FYGP GPY +FAG+DASR LA    ++   KD   D+S L P + E L DW+ +F  KY  VG +
Sbjct:   61 EPPPLPRLKRRDFTPAELRRFDGVQDPR-ILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASRGLATFCLDKEALKDEYDDLSDLTPAQQETLSDWDSQFTFKYHHVGKL 170          
The following BLAST results are available for this feature:
BLAST of FC928843 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 26
Match NameE-valueIdentityDescription
MSBP2_ARATH3.150e-7464.61Membrane steroid-binding protein 2 OS=Arabidopsis ... [more]
MSBP1_ARATH3.259e-7167.59Membrane steroid-binding protein 1 OS=Arabidopsis ... [more]
SBP3_ARATH4.317e-2350.51Probable steroid-binding protein 3 OS=Arabidopsis ... [more]
NENF_RAT2.895e-1945.61Neudesin OS=Rattus norvegicus GN=Nenf PE=2 SV=1[more]
NENF_MOUSE3.201e-1843.86Neudesin OS=Mus musculus GN=Nenf PE=1 SV=1[more]
PGRC1_RAT2.075e-1743.24Membrane-associated progesterone receptor componen... [more]
PGRC1_PIG2.710e-1733.11Membrane-associated progesterone receptor componen... [more]
PGRC1_BOVIN2.710e-1733.11Membrane-associated progesterone receptor componen... [more]
NENF_BOVIN2.710e-1742.11Neudesin OS=Bos taurus GN=NENF PE=2 SV=1[more]
PGRC1_MOUSE4.623e-1742.34Membrane-associated progesterone receptor componen... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAH3AH09RM1 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH3AH09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC928843 ID=FC928843|Name=FC928843|organism=Citrus clementina|type=EST|length=820bp
TTTAAGACCAAACCCCTACAGACTCTGAGTGGATAATACCAAAGGGGACC
GGGGAAAAAAAAAATCTTGACCTCCGTGATGGCTCTGCAACTATGGGAGA
CTCTAAAGGAGGCGATAACAGCGTACACGGGGCTCTCCCCGGCGGCGTTT
TTTACAGTTGTTGCGTTGCTGTGGGCCATATACTATGTTCTGTCGGGAAT
GTTTGGTTCGTCCGATAATCATCATCAGCAGAGATCGAGGGAGTACGAGG
AACAGATGGAGCCTCTGCCACCGCCTGTTCAGCTAGGCGAGATTACCGAG
GAGGAGCTCAAACAGTACGATGGCTCCGATTCCAAAAAGCCCCTTCTCAT
GGCCATCAAGAGCCAGATCTACGATGTCTCTCAGAGCAGGATGTTTTATG
GACCTGGTGGGCCATATGCGTTGTTTGCTGGAAAGGATGCTAGCAGGGCC
CTTGCCAAGATGTCTTTTGAGGAAAAAGATTTAACTGGTGATATCTCTGG
TCTTGGTCCATTTGAGTTGGAGGCATTGCAGGACTGGGAGTATAAGTTCA
TGAGCAAGTATGTTAAGGTTGGATCTATCAAGTCGACAGTTCCAGTAACA
GATGGAGCCTCCTCTGGTGAATCCACTGAGCCTAAAGAAGGAGTTGTTGA
TACACCTGCAGAAAGTAAAGGAGTTGTTGATACACCTGCAGAAACTAAAG
AAGTAGATATCGCTAAGCCTGCTGAATATGGTCCGTCAGAAACTGCAGCC
GCTGGACCTGAGGCAACCCCATCTTCTGATGATACTAAGAAGGAGTAAGC
CGAACCCCATCTGTTGATGA
back to top