FC928844

Overview
NameFC928844
Unique NameFC928844
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length740
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15007 contig Ccv1_Contig15007:1..740. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC928844 vs. ExPASy Swiss-Prot
Match: FKB21_ARATH (FK506-binding protein 2-1 OS=Arabidopsis thaliana GN=FKBP15-1 PE=1 SV=2)

HSP 1 Score: 233.417 bits (594), Expect = 9.748e-61
Identity = 114/140 (81.43%), Postives = 124/140 (88.57%), Query Frame = 3
Query:   57 AISFLLVLS--TLVSANKSGDVTELQIGVKYKPKTCDIQAHKGDKIKVHYRGKLTDGTVFDSSFERGDPIEFELGSGHVIKGWDQGLLGMCVGEKRKLKIPAKLGYGAQGSPPTIPGGATLIFDTELVTVNGKPASGEKT 470
            A+ FLL+L+  TL  A KSGDVTELQIGVKYKP+ CD+QAHKGDKIKVHYRGKLTDGTVFDSSFERGDPIEFELG+G VI GWDQGLLG CVGEKRKLKIP+KLGYG  GSPP IPGGATLIFDTELV VNG+P+S  K+
Sbjct:   10 AVGFLLLLTILTLAYAKKSGDVTELQIGVKYKPQKCDLQAHKGDKIKVHYRGKLTDGTVFDSSFERGDPIEFELGTGQVIPGWDQGLLGACVGEKRKLKIPSKLGYGDNGSPPKIPGGATLIFDTELVAVNGEPSSEAKS 149          
BLAST of FC928844 vs. ExPASy Swiss-Prot
Match: FKB22_ARATH (FK506-binding protein 2-2 OS=Arabidopsis thaliana GN=FKBP15-2 PE=2 SV=2)

HSP 1 Score: 231.106 bits (588), Expect = 4.838e-60
Identity = 111/139 (79.86%), Postives = 122/139 (87.77%), Query Frame = 3
Query:   63 SFLLVLSTLVS----ANKSGDVTELQIGVKYKPKTCDIQAHKGDKIKVHYRGKLTDGTVFDSSFERGDPIEFELGSGHVIKGWDQGLLGMCVGEKRKLKIPAKLGYGAQGSPPTIPGGATLIFDTELVTVNGKPASGEK 467
            S  L+  +L+S    A K+GDV+ELQIGVK+KPKTC++QAHKGD IKVHYRGKLTDGTVFDSSFERGDP EF+LGSG VIKGWDQGLLG CVGEKRKLKIPAKLGYG QGSPPTIPGGATLIFDTEL+ VN KPA GE+
Sbjct:   10 SLFLIFFSLISLQGFAKKTGDVSELQIGVKFKPKTCEVQAHKGDTIKVHYRGKLTDGTVFDSSFERGDPFEFKLGSGQVIKGWDQGLLGACVGEKRKLKIPAKLGYGEQGSPPTIPGGATLIFDTELIAVNEKPAGGEE 148          
BLAST of FC928844 vs. ExPASy Swiss-Prot
Match: FKB15_VICFA (FK506-binding protein 2 OS=Vicia faba GN=FKBP15 PE=1 SV=1)

HSP 1 Score: 225.713 bits (574), Expect = 2.033e-58
Identity = 107/144 (74.31%), Postives = 121/144 (84.03%), Query Frame = 3
Query:   39 VLNIAAAISFLLVLSTLVSANKSGDVTELQIGVKYKPKTCDIQAHKGDKIKVHYRGKLTDGTVFDSSFERGDPIEFELGSGHVIKGWDQGLLGMCVGEKRKLKIPAKLGYGAQGSPPTIPGGATLIFDTELVTVNGKPASGEKT 470
            + +I    +  ++ S LV+A  + DVTELQIGVKYKP +C++QAHKGDK+KVHYRGKLTDGTVFDSSFER  PI+FELG G VIKGWDQGLLGMC+GEKRKLKIPAKLGYG QGSPPTIPGGATLIFDTELV VN K  S EK+
Sbjct:    3 LFSIFLIFTIFIIASALVAAKSAADVTELQIGVKYKPASCEVQAHKGDKVKVHYRGKLTDGTVFDSSFERNSPIDFELGGGQVIKGWDQGLLGMCLGEKRKLKIPAKLGYGEQGSPPTIPGGATLIFDTELVGVNDKSLSEEKS 146          
BLAST of FC928844 vs. ExPASy Swiss-Prot
Match: FKBP2_BOVIN (FK506-binding protein 2 OS=Bos taurus GN=FKBP2 PE=2 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 1.418e-35
Identity = 71/123 (57.72%), Postives = 90/123 (73.17%), Query Frame = 3
Query:   72 LVLSTLVSANKSGDVTELQIGVKYKPKTCDIQAHKGDKIKVHYRGKLTDGTVFDSSFERGDPIEFELGSGHVIKGWDQGLLGMCVGEKRKLKIPAKLGYGAQGSPPTIPGGATLIFDTELVTV 440
            + LS LV+A  +    +LQIGVK +   C I++ KGD + +HY GKL DGT FDSS  +  P  F LG+G VIKGWDQGLLGMC GEKRKL IP++LGYG +G+PP IPGGATL+F+ EL+ +
Sbjct:   12 ICLSALVTATGTEGKRKLQIGVKKRVDHCPIKSRKGDVLHMHYTGKLEDGTEFDSSLPQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPKIPGGATLVFEVELLKI 134          
BLAST of FC928844 vs. ExPASy Swiss-Prot
Match: FKBP2_DICDI (FK506-binding protein 2 OS=Dictyostelium discoideum GN=fkbp2 PE=3 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 3.158e-35
Identity = 72/125 (57.60%), Postives = 88/125 (70.40%), Query Frame = 3
Query:   69 LLVLSTLVSANKSGDVTELQIGVKYKPKTCDIQAHKGDKIKVHYRGKLTDGTVFDSSFERGDPIEFELGSGHVIKGWDQGLLGMCVGEKRKLKIPAKLGYGAQGSPPTIPGGATLIFDTELVTVN 443
            +L L  L S  K  D  +LQIGVKY+P  C ++   GDK+K+HY G L +G  FDSS +RG P EF++G G VIKGWDQG+LGMCVGEKRKL IP  LGYG QG+   IPG + LIFD EL+ +N
Sbjct:   11 ILALVGLSSGAKPSD--KLQIGVKYRPDECTVKTKSGDKLKIHYTGTLLNGDKFDSSVDRGTPFEFKIGVGQVIKGWDQGVLGMCVGEKRKLIIPPSLGYGQQGAGDKIPGNSHLIFDVELIGIN 133          
BLAST of FC928844 vs. ExPASy Swiss-Prot
Match: FKBP2_MOUSE (FK506-binding protein 2 OS=Mus musculus GN=Fkbp2 PE=1 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 4.124e-35
Identity = 70/123 (56.91%), Postives = 89/123 (72.36%), Query Frame = 3
Query:   72 LVLSTLVSANKSGDVTELQIGVKYKPKTCDIQAHKGDKIKVHYRGKLTDGTVFDSSFERGDPIEFELGSGHVIKGWDQGLLGMCVGEKRKLKIPAKLGYGAQGSPPTIPGGATLIFDTELVTV 440
            + LS L +A  +    +LQIGVK +   C I++ KGD + +HY GKL DGT FDSS  +  P  F LG+G VIKGWDQGLLGMC GEKRKL IP++LGYG +G+PP IPGGATL+F+ EL+ +
Sbjct:   12 ICLSALAAATGAEGKRKLQIGVKKRVDHCPIKSRKGDVLHMHYTGKLEDGTEFDSSLPQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPKIPGGATLVFEVELLKI 134          
BLAST of FC928844 vs. ExPASy Swiss-Prot
Match: FKBP2_HUMAN (FK506-binding protein 2 OS=Homo sapiens GN=FKBP2 PE=1 SV=2)

HSP 1 Score: 147.517 bits (371), Expect = 7.035e-35
Identity = 72/141 (51.06%), Postives = 98/141 (69.50%), Query Frame = 3
Query:   18 VKMSFNSVLNIAAAISFLLVLSTLVSANKSGDVTELQIGVKYKPKTCDIQAHKGDKIKVHYRGKLTDGTVFDSSFERGDPIEFELGSGHVIKGWDQGLLGMCVGEKRKLKIPAKLGYGAQGSPPTIPGGATLIFDTELVTV 440
            +++S+  VL + +     + LS + +A  +    +LQIGVK +   C I++ KGD + +HY GKL DGT FDSS  +  P  F LG+G VIKGWDQGLLGMC GEKRKL IP++LGYG +G+PP IPGGATL+F+ EL+ +
Sbjct:    1 MRLSWFRVLTVLS-----ICLSAVATATGAEGKRKLQIGVKKRVDHCPIKSRKGDVLHMHYTGKLEDGTEFDSSLPQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPKIPGGATLVFEVELLKI 136          
BLAST of FC928844 vs. ExPASy Swiss-Prot
Match: FKBP2_YARLI (FK506-binding protein 2 OS=Yarrowia lipolytica GN=FPR2 PE=3 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 1.016e-33
Identity = 71/134 (52.99%), Postives = 94/134 (70.15%), Query Frame = 3
Query:   48 IAAAISFLLVLSTLVSANKSGDVTELQIGV--KYKPKTCDIQAHKGDKIKVHYRGKLTDGTVFDSSFERGDPIEFELGSGHVIKGWDQGLLGMCVGEKRKLKIPAKLGYGAQGSPPTIPGGATLIFDTELVTVN 443
            I   ++F+ +++ + +  +   + +LQIG+  K  P+ C  +A KGD + VHY GKL DGTVFDSS ERG PI+F LG+G VI GWDQG+LGMCVGEKRKL IP  L YG QG+   IP  +TLIF TELV+++
Sbjct:    5 IVLIVAFMALIAGVFATEEK--LAKLQIGILKKISPEECTQKARKGDTVSVHYTGKLEDGTVFDSSVERGQPIQFPLGTGRVIPGWDQGILGMCVGEKRKLTIPPHLAYGKQGAGRVIPPDSTLIFTTELVSID 136          
BLAST of FC928844 vs. ExPASy Swiss-Prot
Match: FKBP2_CRYNE (FK506-binding protein 2 OS=Cryptococcus neoformans GN=FPR2 PE=3 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 1.123e-32
Identity = 69/133 (51.88%), Postives = 92/133 (69.17%), Query Frame = 3
Query:   54 AAISFLLVLSTLVSANKSGDVTELQIGVKYKPKTCDIQAHKGDKIKVHYRGKLT-DGTVFDSSFERGDPIEFELGSGHVIKGWDQGLLGMCVGEKRKLKIPAKLGYGAQGSPPTIPGGATLIFDTELVTVNGK 449
            A I  LL   +L+ A KS +  +LQIGVKY P+ C +++ KGD++ +HY G L  DG+ FDSS +R  P EF LG+G VIKGWDQGLL MC+ EKRKL IP+ L YG +G PP IP  +TL+F+ EL+ +  +
Sbjct:    6 ALIIALLFSLSLILAAKSAE--QLQIGVKYVPEECPVKSRKGDRLSMHYTGTLAKDGSKFDSSLDRNRPFEFTLGAGQVIKGWDQGLLDMCISEKRKLTIPSHLAYGERGHPPVIPPQSTLVFEVELLGIKNR 136          
BLAST of FC928844 vs. ExPASy Swiss-Prot
Match: FKBP2_YEAST (FK506-binding protein 2 OS=Saccharomyces cerevisiae GN=FKB2 PE=1 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 1.622e-31
Identity = 69/122 (56.56%), Postives = 86/122 (70.49%), Query Frame = 3
Query:   84 TLVSANKSGDVTELQIGV--KYKPKTCDIQAHKGDKIKVHYRGKLTD-GTVFDSSFERGDPIEFELGSGHVIKGWDQGLLGMCVGEKRKLKIPAKLGYGAQGSPPTIPGGATLIFDTELVTV 440
            T  S   +G +++L+IG+  +   + C I+A  GDK+KVHY G L + GTVFDSS+ RG PI FELG G VIKGWDQG+ GMCVGEKRKL+IP+ L YG +G P  IP  A L+FD ELV V
Sbjct:   10 TFFSTILAGSLSDLEIGIIKRIPVEDCLIKAMPGDKVKVHYTGSLLESGTVFDSSYSRGSPIAFELGVGRVIKGWDQGVAGMCVGEKRKLQIPSSLAYGERGVPGVIPPSADLVFDVELVDV 131          
The following BLAST results are available for this feature:
BLAST of FC928844 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 130
Match NameE-valueIdentityDescription
FKB21_ARATH9.748e-6181.43FK506-binding protein 2-1 OS=Arabidopsis thaliana ... [more]
FKB22_ARATH4.838e-6079.86FK506-binding protein 2-2 OS=Arabidopsis thaliana ... [more]
FKB15_VICFA2.033e-5874.31FK506-binding protein 2 OS=Vicia faba GN=FKBP15 PE... [more]
FKBP2_BOVIN1.418e-3557.72FK506-binding protein 2 OS=Bos taurus GN=FKBP2 PE=... [more]
FKBP2_DICDI3.158e-3557.60FK506-binding protein 2 OS=Dictyostelium discoideu... [more]
FKBP2_MOUSE4.124e-3556.91FK506-binding protein 2 OS=Mus musculus GN=Fkbp2 P... [more]
FKBP2_HUMAN7.035e-3551.06FK506-binding protein 2 OS=Homo sapiens GN=FKBP2 P... [more]
FKBP2_YARLI1.016e-3352.99FK506-binding protein 2 OS=Yarrowia lipolytica GN=... [more]
FKBP2_CRYNE1.123e-3251.88FK506-binding protein 2 OS=Cryptococcus neoformans... [more]
FKBP2_YEAST1.622e-3156.56FK506-binding protein 2 OS=Saccharomyces cerevisia... [more]

Pages

back to top
Libraries
Library NameType
PhII-IIIV1cdna_library
Properties
Property NameValue
Genbank descriptionKN0AAH3AH10RM1 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH3AH10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC928844 ID=FC928844|Name=FC928844|organism=Citrus clementina|type=EST|length=740bp
GACAAACAGAGAGAATTGTGAAGATGAGTTTCAACTCAGTATTGAATATC
GCCGCTGCAATTTCGTTCCTTTTGGTTCTTTCGACGTTAGTTTCTGCTAA
CAAGTCAGGCGATGTAACAGAGTTACAGATTGGCGTAAAGTACAAGCCAA
AAACCTGTGACATTCAGGCTCACAAAGGTGATAAAATCAAAGTACATTAC
CGGGGAAAACTGACTGATGGAACTGTTTTTGATTCCAGTTTTGAAAGAGG
TGATCCCATTGAATTTGAGCTTGGCAGCGGTCATGTAATCAAAGGATGGG
ACCAAGGACTTTTGGGAATGTGCGTCGGTGAGAAGCGAAAGTTGAAAATT
CCTGCAAAGCTTGGTTATGGGGCCCAGGGTTCTCCCCCTACCATCCCAGG
TGGAGCAACATTGATCTTTGACACCGAGCTTGTAACAGTAAATGGGAAAC
CAGCAAGCGGAGAGAAAACTGAAGATGAGCTATGATTACCTCTCGATTGA
GCAGATTTACCTAAGTCATTCCTGTTGCTTTTAATGTATCGGCATAAACC
AGGTTTCATAGGCCAGAATAATTTATCTATTTAGTGACCTACAGCTGAAC
AATTTTTGTTGTTTGGATCAGAAGAAATCTTTTTAAGGGGACAAAATATT
AATCTCTGAATATTCGGAAGGTTGGTTGCCTCGCTCTTAAGTGATGCGAA
CATAGCATTATTAGATTTTTCGCANAAAAAAAAAAAAAAA
back to top