FC928853

Overview
NameFC928853
Unique NameFC928853
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length509
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig5224 contig Ccv1_Contig5224:581..1089. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC928853 vs. ExPASy Swiss-Prot
Match: CHI1_TOBAC (Endochitinase A OS=Nicotiana tabacum GN=CHN48 PE=1 SV=2)

HSP 1 Score: 154.836 bits (390), Expect = 2.045e-37
Identity = 66/108 (61.11%), Postives = 85/108 (78.70%), Query Frame = 2
Query:    2 ATDPVLSFKSAIWFWMTAQPPKPSCHEVIIDEWKPSANDVNAGRLPGYGLTTNIINGGIECGQGGNAAVRNRIGFFTTFCGKFGIQPGDSLDCYNQRPYGLNLMAQSM 325
            ATDPV+SFKSA+WFWMT Q PKPSCH+VII  W+PSA D  A RLPG+G+ TNIINGG+ECG+G ++ V++RIGF+  +C   G+ PGD+LDC NQR +G  L+  +M
Sbjct:  222 ATDPVISFKSALWFWMTPQSPKPSCHDVIIGRWQPSAGDRAANRLPGFGVITNIINGGLECGRGTDSRVQDRIGFYRRYCSILGVSPGDNLDCGNQRSFGNGLLVDTM 329          
BLAST of FC928853 vs. ExPASy Swiss-Prot
Match: CHI2_TOBAC (Endochitinase B OS=Nicotiana tabacum GN=CHN50 PE=1 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 7.771e-37
Identity = 65/108 (60.19%), Postives = 85/108 (78.70%), Query Frame = 2
Query:    2 ATDPVLSFKSAIWFWMTAQPPKPSCHEVIIDEWKPSANDVNAGRLPGYGLTTNIINGGIECGQGGNAAVRNRIGFFTTFCGKFGIQPGDSLDCYNQRPYGLNLMAQSM 325
            ATDPV+SFKSA+WFWMT Q PKPSCH+VII  W+PS+ D  A RLPG+G+ TNIINGG+ECG+G ++ V++RIGF+  +C   G+ PGD+LDC NQR +G  L+  +M
Sbjct:  217 ATDPVISFKSALWFWMTPQSPKPSCHDVIIGRWQPSSADRAANRLPGFGVITNIINGGLECGRGTDSRVQDRIGFYRRYCSILGVSPGDNLDCGNQRSFGNGLLVDTM 324          
BLAST of FC928853 vs. ExPASy Swiss-Prot
Match: CHI2_PEA (Endochitinase A2 OS=Pisum sativum GN=CHI2 PE=1 SV=2)

HSP 1 Score: 152.91 bits (385), Expect = 7.771e-37
Identity = 67/108 (62.04%), Postives = 85/108 (78.70%), Query Frame = 2
Query:    2 ATDPVLSFKSAIWFWMTAQPPKPSCHEVIIDEWKPSANDVNAGRLPGYGLTTNIINGGIECGQGGNAAVRNRIGFFTTFCGKFGIQPGDSLDCYNQRPYGLNLMAQSM 325
            ATDPV+SFK+A+WFWMT Q PKPSCH+VI   W PS+ D  AGRLPGYG  TNIINGG+ECG+G ++ V++RIGF+  +C  FGI  GD+LDCY+QRP+G +L   S+
Sbjct:  209 ATDPVISFKTALWFWMTPQSPKPSCHDVITGGWTPSSADRAAGRLPGYGTVTNIINGGLECGRGQDSRVQDRIGFYKRYCDIFGIGYGDNLDCYSQRPFGSSLPLSSI 316          
BLAST of FC928853 vs. ExPASy Swiss-Prot
Match: CHIT_CARPA (Endochitinase OS=Carica papaya PE=1 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 1.326e-36
Identity = 63/100 (63.00%), Postives = 80/100 (80.00%), Query Frame = 2
Query:    2 ATDPVLSFKSAIWFWMTAQPPKPSCHEVIIDEWKPSANDVNAGRLPGYGLTTNIINGGIECGQGGNAAVRNRIGFFTTFCGKFGIQPGDSLDCYNQRPYG 301
            ATD VLSFK+A+WFWMT Q PKPSCH+V+   W+PSA D  AGRLPGYG+ TN++NGG+ECG+G N  V +R+GFF  +CG  G+  G++LDCYNQRP+G
Sbjct:  144 ATDRVLSFKTALWFWMTPQAPKPSCHDVLTGRWQPSAADTAAGRLPGYGVLTNLLNGGLECGKGPNPQVADRLGFFRRYCGLLGVGTGNNLDCYNQRPFG 243          
BLAST of FC928853 vs. ExPASy Swiss-Prot
Match: CHI1_THECC (Endochitinase 1 OS=Theobroma cacao GN=CHIA1 PE=2 SV=1)

HSP 1 Score: 151.754 bits (382), Expect = 1.731e-36
Identity = 67/108 (62.04%), Postives = 79/108 (73.15%), Query Frame = 2
Query:    2 ATDPVLSFKSAIWFWMTAQPPKPSCHEVIIDEWKPSANDVNAGRLPGYGLTTNIINGGIECGQGGNAAVRNRIGFFTTFCGKFGIQPGDSLDCYNQRPYGLNLMAQSM 325
            ATDP +SFKSA WFWMT Q PKPSCH+VII  W PS +D  AGR+PG+GL TNIINGG+ECGQG NA V +RIGF+  +C   G+  G++LDCYNQR Y       SM
Sbjct:  214 ATDPTISFKSAFWFWMTPQSPKPSCHDVIIGAWSPSGSDQAAGRVPGFGLITNIINGGLECGQGWNAKVEDRIGFYKRYCDTLGVGYGNNLDCYNQRSYNNGPSVDSM 321          
BLAST of FC928853 vs. ExPASy Swiss-Prot
Match: CHIC_SOLLC (Basic 30 kDa endochitinase OS=Solanum lycopersicum GN=CHI9 PE=1 SV=1)

HSP 1 Score: 150.599 bits (379), Expect = 3.857e-36
Identity = 64/108 (59.26%), Postives = 82/108 (75.93%), Query Frame = 2
Query:    2 ATDPVLSFKSAIWFWMTAQPPKPSCHEVIIDEWKPSANDVNAGRLPGYGLTTNIINGGIECGQGGNAAVRNRIGFFTTFCGKFGIQPGDSLDCYNQRPYGLNLMAQSM 325
            ATDPV+SFKSAIWFWMT Q PKPSCH+VI   W+PS  D  A R+PG+G+ TNIINGG+ECG G ++ V++RIGF+  +CG  G+ PG++LDC NQR +G  L+   M
Sbjct:  215 ATDPVISFKSAIWFWMTPQSPKPSCHDVITGRWQPSGADQAANRVPGFGVITNIINGGLECGHGSDSRVQDRIGFYRRYCGILGVSPGENLDCGNQRSFGNGLLVDIM 322          
BLAST of FC928853 vs. ExPASy Swiss-Prot
Match: CHI1_GOSHI (Endochitinase 1 OS=Gossypium hirsutum PE=3 SV=1)

HSP 1 Score: 150.214 bits (378), Expect = 5.037e-36
Identity = 64/108 (59.26%), Postives = 81/108 (75.00%), Query Frame = 2
Query:    2 ATDPVLSFKSAIWFWMTAQPPKPSCHEVIIDEWKPSANDVNAGRLPGYGLTTNIINGGIECGQGGNAAVRNRIGFFTTFCGKFGIQPGDSLDCYNQRPYGLNLMAQSM 325
            ++DP +SFKSA WFWMT Q PKPSCH VII  W PS++D  AGR+PGYG+ TNIINGG+ECG+G NA V +RIGF+  +C   G+  G++LDCYNQ P+G  +   SM
Sbjct:  217 SSDPTISFKSAFWFWMTPQSPKPSCHNVIIGAWSPSSSDRAAGRVPGYGVITNIINGGLECGKGWNAQVEDRIGFYKRYCDILGVSYGNNLDCYNQSPFGNGVSVDSM 324          
BLAST of FC928853 vs. ExPASy Swiss-Prot
Match: CHIB_POPTR (Acidic endochitinase WIN6.2B OS=Populus trichocarpa PE=2 SV=2)

HSP 1 Score: 149.828 bits (377), Expect = 6.579e-36
Identity = 66/104 (63.46%), Postives = 78/104 (75.00%), Query Frame = 2
Query:    5 TDPVLSFKSAIWFWMTAQPPKPSCHEVIIDEWKPSANDVNAGRLPGYGLTTNIINGGIECGQGG-NAAVRNRIGFFTTFCGKFGIQPGDSLDCYNQRPYGLNLM 313
            TDP ++FK+A+WFWMT Q PKPSCH VI + W PSA D  AGR+PGYG+ TNIINGGIECGQGG N A  NRIGF+ T+C   G   G +LDCY QRP+G  L+
Sbjct:  194 TDPFIAFKTALWFWMTPQSPKPSCHAVITESWTPSAADSEAGRVPGYGVITNIINGGIECGQGGPNNANENRIGFYKTYCDSLGTTYGSNLDCYQQRPFGYGLL 297          
BLAST of FC928853 vs. ExPASy Swiss-Prot
Match: CHI1_SOLTU (Endochitinase 1 (Fragment) OS=Solanum tuberosum GN=CHTB1 PE=2 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 6.579e-36
Identity = 64/108 (59.26%), Postives = 82/108 (75.93%), Query Frame = 2
Query:    2 ATDPVLSFKSAIWFWMTAQPPKPSCHEVIIDEWKPSANDVNAGRLPGYGLTTNIINGGIECGQGGNAAVRNRIGFFTTFCGKFGIQPGDSLDCYNQRPYGLNLMAQSM 325
            ATD V+SFKSAIWFWMT Q PKPSCH+VI   W+PS  D  A R+PG+G+ TNIINGG+ECG G ++ V++RIGF+  +CG  G+ PGD+LDC NQR +G  L+  +M
Sbjct:  211 ATDSVISFKSAIWFWMTPQSPKPSCHDVITGRWQPSGVDQAANRVPGFGVITNIINGGLECGHGSDSRVQDRIGFYRRYCGILGVSPGDNLDCGNQRSFGNGLLVDTM 318          
BLAST of FC928853 vs. ExPASy Swiss-Prot
Match: CHI2_SOLTU (Endochitinase 2 (Fragment) OS=Solanum tuberosum GN=CHTB2 PE=2 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 1.122e-35
Identity = 62/108 (57.41%), Postives = 82/108 (75.93%), Query Frame = 2
Query:    2 ATDPVLSFKSAIWFWMTAQPPKPSCHEVIIDEWKPSANDVNAGRLPGYGLTTNIINGGIECGQGGNAAVRNRIGFFTTFCGKFGIQPGDSLDCYNQRPYGLNLMAQSM 325
            ATD ++SFKSAIWFWMT Q PKPSCH+VI   W+PS  D  A R+PG+G+ TNIINGG+ECG G ++ V++RIGF+  +CG  G+ PGD+LDC NQR +G  L+  ++
Sbjct:  209 ATDSIISFKSAIWFWMTPQSPKPSCHDVITGRWQPSGTDQAANRVPGFGVITNIINGGLECGHGSDSRVQDRIGFYRRYCGILGVSPGDNLDCGNQRSFGNGLLVDTV 316          
The following BLAST results are available for this feature:
BLAST of FC928853 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 47
Match NameE-valueIdentityDescription
CHI1_TOBAC2.045e-3761.11Endochitinase A OS=Nicotiana tabacum GN=CHN48 PE=1... [more]
CHI2_TOBAC7.771e-3760.19Endochitinase B OS=Nicotiana tabacum GN=CHN50 PE=1... [more]
CHI2_PEA7.771e-3762.04Endochitinase A2 OS=Pisum sativum GN=CHI2 PE=1 SV=... [more]
CHIT_CARPA1.326e-3663.00Endochitinase OS=Carica papaya PE=1 SV=1[more]
CHI1_THECC1.731e-3662.04Endochitinase 1 OS=Theobroma cacao GN=CHIA1 PE=2 S... [more]
CHIC_SOLLC3.857e-3659.26Basic 30 kDa endochitinase OS=Solanum lycopersicum... [more]
CHI1_GOSHI5.037e-3659.26Endochitinase 1 OS=Gossypium hirsutum PE=3 SV=1[more]
CHIB_POPTR6.579e-3663.46Acidic endochitinase WIN6.2B OS=Populus trichocarp... [more]
CHI1_SOLTU6.579e-3659.26Endochitinase 1 (Fragment) OS=Solanum tuberosum GN... [more]
CHI2_SOLTU1.122e-3557.41Endochitinase 2 (Fragment) OS=Solanum tuberosum GN... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAH1CA07RM2 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH1CA07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC928853 ID=FC928853|Name=FC928853|organism=Citrus clementina|type=EST|length=509bp
TGCTACTGATCCAGTACTATCATTCAAGTCAGCAATCTGGTTCTGGATGA
CTGCACAGCCACCAAAGCCATCGTGCCACGAAGTCATTATCGACGAATGG
AAACCATCAGCAAATGACGTAAACGCCGGCCGGCTTCCGGGATACGGTCT
AACCACAAATATAATCAACGGTGGAATTGAATGTGGCCAAGGTGGGAATG
CCGCTGTACGTAACCGTATTGGGTTCTTTACCACTTTCTGTGGCAAGTTT
GGGATTCAGCCTGGTGACAGTCTTGATTGCTACAACCAACGACCTTATGG
CCTTAATCTGATGGCACAATCTATGTGATCATCATGATCAACGTTTTAGT
AAAATAAGCTTAATAAAAGCTACTTAATAAAAACTTTAGATGTCACACTT
GTAGGTGGACAACTAAATTGTTAGTTTGTTACGCTCTTATTGTAAGTAAA
TTAAATAAGACTGATCCAACATGGATCAATGAGTCTTCACCAAAAAAAAA
AAAAAAAAA
back to top