FC928876

Overview
NameFC928876
Unique NameFC928876
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length842
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14474 contig Ccv1_Contig14474:179..1020. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC928876 vs. ExPASy Swiss-Prot
Match: PSB1_PETHY (Proteasome subunit beta type-1 OS=Petunia hybrida GN=PBF1 PE=2 SV=1)

HSP 1 Score: 375.17 bits (962), Expect = 2.556e-103
Identity = 183/199 (91.96%), Postives = 192/199 (96.48%), Query Frame = 3
Query:    3 DYCVIAADTRMSTGYSILTRDYSKICKLADKCVMASSGFQADVKALQKLLAARHLIYQHQHNKQMSCPGMAQLLSNTLYYKRFFPYYSFNVLGGLDNEGKGCVYTYDAVGSYERVGYSSQGSGSTLIMPFLDNQLKSPSPLLLPAQDAVTPLSEAEAVDLVKTCFASATERDIYTGDKLEIVVLNKGGIHREYMELRKD 599
            DYCVIAADTRMSTGY+ILTRDYSKI KLADKCVMASSGFQADV+ALQK+LA+RHLIYQHQHNKQMSCP M QLLSNTLYYKRFFPYYSFNVLGGLD+EGKGCV+TYDAVGSYERVGYSSQGSGSTLIMPFLDNQLKSPSPLLLPAQDAVTPLSEAEA+DLVKTCFASATERDIYTGD+LEIV+LN  GI RE MELRKD
Sbjct:   25 DYCVIAADTRMSTGYNILTRDYSKIIKLADKCVMASSGFQADVRALQKVLASRHLIYQHQHNKQMSCPAMGQLLSNTLYYKRFFPYYSFNVLGGLDSEGKGCVFTYDAVGSYERVGYSSQGSGSTLIMPFLDNQLKSPSPLLLPAQDAVTPLSEAEAIDLVKTCFASATERDIYTGDRLEIVILNASGIRREEMELRKD 223          
BLAST of FC928876 vs. ExPASy Swiss-Prot
Match: PSB1_ARATH (Proteasome subunit beta type-1 OS=Arabidopsis thaliana GN=PBF1 PE=1 SV=2)

HSP 1 Score: 346.665 bits (888), Expect = 9.734e-95
Identity = 170/199 (85.43%), Postives = 184/199 (92.46%), Query Frame = 3
Query:    3 DYCVIAADTRMSTGYSILTRDYSKICKLADKCVMASSGFQADVKALQKLLAARHLIYQHQHNKQMSCPGMAQLLSNTLYYKRFFPYYSFNVLGGLDNEGKGCVYTYDAVGSYERVGYSSQGSGSTLIMPFLDNQLKSPSPLLLPAQDAVTPLSEAEAVDLVKTCFASATERDIYTGDKLEIVVLNKGGIHREYMELRKD 599
            DYCVIAADTRMSTGYSIL+RDYSKI KLAD+ V++SSGFQADVKALQK+L +RHLIYQHQHNKQMSCP MAQLLSNTLY+KRFFPYY+FNVLGGLD EGKGCV+TYDAVGSYERVGY +QGSGSTLIMPFLDNQLKSPSPLLLP QD+ TPLSEAEAVDLVKT FASATERDIYTGDKLEI++L   GI  E M+LRKD
Sbjct:   25 DYCVIAADTRMSTGYSILSRDYSKIHKLADRAVLSSSGFQADVKALQKVLKSRHLIYQHQHNKQMSCPAMAQLLSNTLYFKRFFPYYAFNVLGGLDEEGKGCVFTYDAVGSYERVGYGAQGSGSTLIMPFLDNQLKSPSPLLLPKQDSNTPLSEAEAVDLVKTVFASATERDIYTGDKLEIMILKADGIKTELMDLRKD 223          
BLAST of FC928876 vs. ExPASy Swiss-Prot
Match: PSB1_ORYSJ (Proteasome subunit beta type-1 OS=Oryza sativa subsp. japonica GN=PBF1 PE=2 SV=1)

HSP 1 Score: 345.51 bits (885), Expect = 2.169e-94
Identity = 165/199 (82.91%), Postives = 183/199 (91.96%), Query Frame = 3
Query:    3 DYCVIAADTRMSTGYSILTRDYSKICKLADKCVMASSGFQADVKALQKLLAARHLIYQHQHNKQMSCPGMAQLLSNTLYYKRFFPYYSFNVLGGLDNEGKGCVYTYDAVGSYERVGYSSQGSGSTLIMPFLDNQLKSPSPLLLPAQDAVTPLSEAEAVDLVKTCFASATERDIYTGDKLEIVVLNKGGIHREYMELRKD 599
            DYCV+AADTR+S GY+ILTRD+SKIC+LADKC +ASSGFQ D+KAL K LAAR L+YQHQHNK+MSCP MAQLLSNTLYYKRFFPYY+FNVLGGLD+EGKGCV+TYDAVGSYER GYS+QG+GS LIMP LDNQLKSPSPLLLPA+DAVTPLSE EAVDLVK  FASATERDIYTGDKLEIVV+NK G  REY++LRKD
Sbjct:   23 DYCVVAADTRLSVGYNILTRDHSKICELADKCALASSGFQGDIKALHKNLAARELLYQHQHNKRMSCPAMAQLLSNTLYYKRFFPYYAFNVLGGLDSEGKGCVFTYDAVGSYERTGYSAQGTGSALIMPVLDNQLKSPSPLLLPARDAVTPLSETEAVDLVKDVFASATERDIYTGDKLEIVVINKAGTKREYIDLRKD 221          
BLAST of FC928876 vs. ExPASy Swiss-Prot
Match: PSB1_DICDI (Proteasome subunit beta type-1 OS=Dictyostelium discoideum GN=psmB1 PE=3 SV=1)

HSP 1 Score: 209.534 bits (532), Expect = 1.857e-53
Identity = 109/200 (54.50%), Postives = 140/200 (70.00%), Query Frame = 3
Query:    3 DYCVIAADTRMSTG-YSILTRDYSKICKLADKCVMASSGFQADVKALQKLLAARHLIYQHQHNKQMSCPGMAQLLSNTLYYKRFFPYYSFNVLGGLDNEGKGCVYTYDAVGSYERVGYSSQGSGSTLIMPFLDNQLKSPSPLLLPAQDAVTPLSEAEAVDLVKTCFASATERDIYTGDKLEIVVLNKGGIHREYMELRKD 599
            DYCVIA DTRMS G Y I TR Y+KI +L  KCV+A+SG QAD  ALQK L +    ++ +H K MS P +AQ LSNTLYYKRFFPYY+FN++ G+D +G+G ++TYDAVGS+ERV YSSQGSG+ L++P LDNQ+   +  ++     V   S  + V  VK    SA ERDIYTGD  +IVV++K G+H E  EL+ D
Sbjct:   40 DYCVIAGDTRMSDGGYGIQTRKYTKIFQLTKKCVLATSGMQADTIALQKRLKSMLESFEKEHGKPMSTPAIAQFLSNTLYYKRFFPYYTFNLVAGVDEQGEGWIWTYDAVGSHERVKYSSQGSGNQLVIPLLDNQVAKFNQQIVEGNKDV---SCEQVVSFVKDSITSAGERDIYTGDFADIVVVDKNGVHWEKFELKLD 236          
BLAST of FC928876 vs. ExPASy Swiss-Prot
Match: PSB1B_CARAU (Proteasome subunit beta type-1-B OS=Carassius auratus GN=psmb1-B PE=2 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 7.558e-47
Identity = 94/199 (47.24%), Postives = 129/199 (64.82%), Query Frame = 3
Query:    3 DYCVIAADTRMSTGYSILTRDYSKICKLADKCVMASSGFQADVKALQKLLAARHLIYQHQHNKQMSCPGMAQLLSNTLYYKRFFPYYSFNVLGGLDNEGKGCVYTYDAVGSYERVGYSSQGSGSTLIMPFLDNQLKSPSPLLLPAQDAVTPLSEAEAVDLVKTCFASATERDIYTGDKLEIVVLNKGGIHREYMELRKD 599
            D+ ++A+DTR+S GYSI +RD  K  KL D  V+  SGF  D   L K++ AR  +Y+H +NK M+   +A +LS  LY +RFFPYY +N++GGLD EG+G VY++D VGSY+R  Y + GS S ++ P LDNQ+   +           PLS+ +AV LVK  F SA ERD+YTGD L+I ++ K GI  E + LRKD
Sbjct:   43 DFALVASDTRLSEGYSIHSRDSPKCYKLTDTTVIGCSGFHGDCLTLTKIIEARLKMYKHSNNKSMTSGAIAAMLSTILYGRRFFPYYVYNIIGGLDEEGRGAVYSFDPVGSYQRDTYKAGGSASAMLQPLLDNQIGFKN----MENVEQVPLSQEKAVQLVKDVFISAAERDVYTGDALKICIITKEGIREEIVPLRKD 237          
BLAST of FC928876 vs. ExPASy Swiss-Prot
Match: PSB1A_CARAU (Proteasome subunit beta type-1-A OS=Carassius auratus GN=psmb1-A PE=2 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 7.558e-47
Identity = 94/199 (47.24%), Postives = 129/199 (64.82%), Query Frame = 3
Query:    3 DYCVIAADTRMSTGYSILTRDYSKICKLADKCVMASSGFQADVKALQKLLAARHLIYQHQHNKQMSCPGMAQLLSNTLYYKRFFPYYSFNVLGGLDNEGKGCVYTYDAVGSYERVGYSSQGSGSTLIMPFLDNQLKSPSPLLLPAQDAVTPLSEAEAVDLVKTCFASATERDIYTGDKLEIVVLNKGGIHREYMELRKD 599
            D+ ++A+DTR+S GYSI +RD  K  KL D  V+  SGF  D   L K++ AR  +Y+H +NK M+   +A +LS  LY +RFFPYY +N++GGLD EG+G VY++D VGSY+R  Y + GS S ++ P LDNQ+   +           PLS+ +AV LVK  F SA ERD+YTGD L+I ++ K GI  E + LRKD
Sbjct:   44 DFALVASDTRLSEGYSIHSRDSPKCYKLTDTTVIGCSGFHGDCLTLTKIIEARLKMYKHSNNKSMTSGAIAAMLSTILYGRRFFPYYVYNIIGGLDEEGRGAVYSFDPVGSYQRDTYKAGGSASAMLQPLLDNQIGFKN----MENVEQVPLSQEKAVQLVKDVFISAAERDVYTGDALKICIITKEGIREEIVPLRKD 238          
BLAST of FC928876 vs. ExPASy Swiss-Prot
Match: PSB1_HUMAN (Proteasome subunit beta type-1 OS=Homo sapiens GN=PSMB1 PE=1 SV=2)

HSP 1 Score: 185.267 bits (469), Expect = 3.751e-46
Identity = 94/199 (47.24%), Postives = 128/199 (64.32%), Query Frame = 3
Query:    3 DYCVIAADTRMSTGYSILTRDYSKICKLADKCVMASSGFQADVKALQKLLAARHLIYQHQHNKQMSCPGMAQLLSNTLYYKRFFPYYSFNVLGGLDNEGKGCVYTYDAVGSYERVGYSSQGSGSTLIMPFLDNQLKSPSPLLLPAQDAVTPLSEAEAVDLVKTCFASATERDIYTGDKLEIVVLNKGGIHREYMELRKD 599
            D+ ++A+DTR+S G+SI TRD  K  KL DK V+  SGF  D   L K++ AR  +Y+H +NK M+   +A +LS  LY +RFFPYY +N++GGLD EGKG VY++D VGSY+R  + + GS S ++ P LDNQ+   +   +       PLS   A+ LVK  F SA ERD+YTGD L I ++ K GI  E + LRKD
Sbjct:   47 DFAIVASDTRLSEGFSIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQVGFKNMQNVEH----VPLSLDRAMRLVKDVFISAAERDVYTGDALRICIVTKEGIREETVSLRKD 241          
BLAST of FC928876 vs. ExPASy Swiss-Prot
Match: PSB1_BOVIN (Proteasome subunit beta type-1 OS=Bos taurus GN=PSMB1 PE=1 SV=1)

HSP 1 Score: 183.726 bits (465), Expect = 1.091e-45
Identity = 93/199 (46.73%), Postives = 129/199 (64.82%), Query Frame = 3
Query:    3 DYCVIAADTRMSTGYSILTRDYSKICKLADKCVMASSGFQADVKALQKLLAARHLIYQHQHNKQMSCPGMAQLLSNTLYYKRFFPYYSFNVLGGLDNEGKGCVYTYDAVGSYERVGYSSQGSGSTLIMPFLDNQLKSPSPLLLPAQDAVTPLSEAEAVDLVKTCFASATERDIYTGDKLEIVVLNKGGIHREYMELRKD 599
            D+ ++A+DTR+S G+SI TRD  K  KL DK V+  SGF  D   L K++ AR  +Y+H +NK M+   +A +LS  LY +RFFPYY +N++GGLD EGKG VY++D VGSY+R  + + GS S ++ P LDNQ+   +   +       PLS   A+ LVK  F SA ERD+YTGD L++ ++ K GI  E + LRKD
Sbjct:   47 DFSIVASDTRLSEGFSIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQVGFKNMQNVEH----VPLSLDRAMRLVKDVFISAAERDVYTGDALKVCIVTKEGIRGETVPLRKD 241          
BLAST of FC928876 vs. ExPASy Swiss-Prot
Match: PSB1_MOUSE (Proteasome subunit beta type-1 OS=Mus musculus GN=Psmb1 PE=1 SV=1)

HSP 1 Score: 183.341 bits (464), Expect = 1.425e-45
Identity = 93/199 (46.73%), Postives = 128/199 (64.32%), Query Frame = 3
Query:    3 DYCVIAADTRMSTGYSILTRDYSKICKLADKCVMASSGFQADVKALQKLLAARHLIYQHQHNKQMSCPGMAQLLSNTLYYKRFFPYYSFNVLGGLDNEGKGCVYTYDAVGSYERVGYSSQGSGSTLIMPFLDNQLKSPSPLLLPAQDAVTPLSEAEAVDLVKTCFASATERDIYTGDKLEIVVLNKGGIHREYMELRKD 599
            D+ ++A+DTR+S G+SI TRD  K  KL DK V+  SGF  D   L K++ AR  +Y+H +NK M+   +A +LS  LY +RFFPYY +N++GGLD EGKG VY++D VGSY+R  + + GS S ++ P LDNQ+   +   +       PL+   A+ LVK  F SA ERD+YTGD L I ++ K GI  E + LRKD
Sbjct:   46 DFSIVASDTRLSEGFSIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQVGFKNMQNVEH----VPLTLDRAMRLVKDVFISAAERDVYTGDALRICIVTKEGIREETVPLRKD 240          
BLAST of FC928876 vs. ExPASy Swiss-Prot
Match: PSB1_RAT (Proteasome subunit beta type-1 OS=Rattus norvegicus GN=Psmb1 PE=1 SV=3)

HSP 1 Score: 180.259 bits (456), Expect = 1.207e-44
Identity = 92/199 (46.23%), Postives = 127/199 (63.82%), Query Frame = 3
Query:    3 DYCVIAADTRMSTGYSILTRDYSKICKLADKCVMASSGFQADVKALQKLLAARHLIYQHQHNKQMSCPGMAQLLSNTLYYKRFFPYYSFNVLGGLDNEGKGCVYTYDAVGSYERVGYSSQGSGSTLIMPFLDNQLKSPSPLLLPAQDAVTPLSEAEAVDLVKTCFASATERDIYTGDKLEIVVLNKGGIHREYMELRKD 599
            D+ ++A+DTR+S G+SI TRD  K  KL DK V+  SGF  D   L K++ AR  +Y+H +NK M+   +A +LS  LY +RFFPYY +N++ GLD EGKG VY++D VGSY+R  + + GS S ++ P LDNQ+   +   +       PL+   A+ LVK  F SA ERD+YTGD L I ++ K GI  E + LRKD
Sbjct:   46 DFSIVASDTRLSEGFSIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAMLSTILYSRRFFPYYVYNIIEGLDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQVGFKNMQNVEH----VPLTLDRAMRLVKDVFISAAERDVYTGDALRICIVTKEGIREETVPLRKD 240          
The following BLAST results are available for this feature:
BLAST of FC928876 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 32
Match NameE-valueIdentityDescription
PSB1_PETHY2.556e-10391.96Proteasome subunit beta type-1 OS=Petunia hybrida ... [more]
PSB1_ARATH9.734e-9585.43Proteasome subunit beta type-1 OS=Arabidopsis thal... [more]
PSB1_ORYSJ2.169e-9482.91Proteasome subunit beta type-1 OS=Oryza sativa sub... [more]
PSB1_DICDI1.857e-5354.50Proteasome subunit beta type-1 OS=Dictyostelium di... [more]
PSB1B_CARAU7.558e-4747.24Proteasome subunit beta type-1-B OS=Carassius aura... [more]
PSB1A_CARAU7.558e-4747.24Proteasome subunit beta type-1-A OS=Carassius aura... [more]
PSB1_HUMAN3.751e-4647.24Proteasome subunit beta type-1 OS=Homo sapiens GN=... [more]
PSB1_BOVIN1.091e-4546.73Proteasome subunit beta type-1 OS=Bos taurus GN=PS... [more]
PSB1_MOUSE1.425e-4546.73Proteasome subunit beta type-1 OS=Mus musculus GN=... [more]
PSB1_RAT1.207e-4446.23Proteasome subunit beta type-1 OS=Rattus norvegicu... [more]

Pages

back to top
Libraries
Library NameType
PhII-IIIV1cdna_library
Properties
Property NameValue
Genbank descriptionKN0AAH1CC07RM2 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH1CC07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC928876 ID=FC928876|Name=FC928876|organism=Citrus clementina|type=EST|length=842bp
CTGATTACTGTGTAATCGCTGCCGACACTCGAATGTCAACCGGTTACAGT
ATCCTCACTCGCGATTACTCCAAAATCTGTAAACTGGCAGACAAATGTGT
TATGGCCTCTTCTGGTTTTCAAGCTGATGTGAAAGCCTTACAAAAACTCT
TGGCAGCAAGGCACTTGATCTATCAGCATCAGCACAACAAGCAAATGAGC
TGCCCTGGAATGGCTCAACTACTCTCCAACACCCTGTACTACAAGCGTTT
CTTTCCTTACTATTCATTTAATGTCTTGGGTGGGCTTGACAATGAAGGGA
AGGGTTGTGTCTACACATATGATGCTGTTGGTTCCTATGAGAGGGTTGGA
TATAGCTCCCAAGGTTCTGGGTCCACGCTCATCATGCCATTCCTGGATAA
CCAACTAAAGTCTCCCAGTCCTCTCCTACTGCCTGCCCAGGATGCTGTTA
CTCCTCTTTCAGAGGCTGAAGCAGTTGATTTGGTCAAAACTTGTTTTGCA
TCAGCAACTGAGAGAGACATATACACGGGAGACAAACTTGAAATTGTTGT
CCTAAACAAAGGTGGTATTCATCGTGAATACATGGAACTGAGGAAGGATT
AATCTCTTTGGCATCATGCCACGCTCGTCAAGCTGAAGTGGGTGGAGCTG
CCACGAGCAAAATTTCAGTGTTCTTATGTTGTCATGGTTTCACATTTTGA
TATGAATCCAGTTTGATATGTCTTTCCTTGCTAGTGGATATGTTGCGGTG
ATGATGCCAATAGGAGACATTAGTTTCTTCTACTCTAACATTAGATCTGG
TGTTATTGTCGTTGAGGATAAATTGTATATTTGGTATTCAAT
back to top