FC928881

Overview
NameFC928881
Unique NameFC928881
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length512
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC928881 vs. ExPASy Swiss-Prot
Match: CHI2_PEA (Endochitinase A2 OS=Pisum sativum GN=CHI2 PE=1 SV=2)

HSP 1 Score: 108.612 bits (270), Expect = 1.613e-26
Identity = 46/86 (53.49%), Postives = 61/86 (70.93%), Query Frame = 1
Query:    1 IATDPVLSFKSTLWFWMTAPPPIPSCRELLIDEWKPSSNDVDPRRLPGYGQTTNIVNGGIECGQRGNAAVHNRIGYFTTFCGKFGI 258
            +ATDPV+SFK+ LWFWMT   P PSC +++   W PSS D    RLPGYG  TNI+NGG+ECG+  ++ V +RIG++  +C  FGI
Sbjct:  208 VATDPVISFKTALWFWMTPQSPKPSCHDVITGGWTPSSADRAAGRLPGYGTVTNIINGGLECGRGQDSRVQDRIGFYKRYCDIFGI 293          

HSP 2 Score: 32.3426 bits (72), Expect = 1.613e-26
Identity = 13/25 (52.00%), Postives = 17/25 (68.00%), Query Frame = 2
Query:  254 GFSTGDSLDCYYQRPYGINLMAQSM 328
            G   GD+LDCY QRP+G +L   S+
Sbjct:  292 GIGYGDNLDCYSQRPFGSSLPLSSI 316          
BLAST of FC928881 vs. ExPASy Swiss-Prot
Match: CHIT_PHAVU (Endochitinase OS=Phaseolus vulgaris PE=1 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 2.731e-26
Identity = 47/86 (54.65%), Postives = 61/86 (70.93%), Query Frame = 1
Query:    1 IATDPVLSFKSTLWFWMTAPPPIPSCRELLIDEWKPSSNDVDPRRLPGYGQTTNIVNGGIECGQRGNAAVHNRIGYFTTFCGKFGI 258
            +ATD V+SFKS LWFWMTA  P PS  +++   W PSS DV  RRLPGYG  TNI+NGG+ECG+  ++ V +RIG+F  +C   G+
Sbjct:  216 VATDSVISFKSALWFWMTAQSPKPSSHDVITSRWTPSSADVAARRLPGYGTVTNIINGGLECGRGQDSRVQDRIGFFKRYCDLLGV 301          

HSP 2 Score: 30.0314 bits (66), Expect = 2.731e-26
Identity = 12/30 (40.00%), Postives = 20/30 (66.67%), Query Frame = 2
Query:  251 LGFSTGDSLDCYYQRPYGINLMAQSM*SSR 340
            LG   G++LDCY Q P+G +L+   + +S+
Sbjct:  299 LGVGYGNNLDCYSQTPFGNSLLLSDLVTSQ 328          
BLAST of FC928881 vs. ExPASy Swiss-Prot
Match: CHI5_PHAVU (Endochitinase CH5B OS=Phaseolus vulgaris PE=3 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 4.628e-26
Identity = 47/86 (54.65%), Postives = 61/86 (70.93%), Query Frame = 1
Query:    1 IATDPVLSFKSTLWFWMTAPPPIPSCRELLIDEWKPSSNDVDPRRLPGYGQTTNIVNGGIECGQRGNAAVHNRIGYFTTFCGKFGI 258
            +ATD V+SFKS LWFWMTA  P PS  +++   W PSS DV  RRLPGYG  TNI+NGG+ECG+  ++ V +RIG+F  +C   G+
Sbjct:  215 VATDSVISFKSALWFWMTAQSPKPSSHDVITSRWTPSSADVAARRLPGYGTVTNIINGGLECGRGQDSRVQDRIGFFKRYCDLLGV 300          

HSP 2 Score: 29.261 bits (64), Expect = 4.628e-26
Identity = 12/30 (40.00%), Postives = 19/30 (63.33%), Query Frame = 2
Query:  251 LGFSTGDSLDCYYQRPYGINLMAQSM*SSR 340
            LG   G++LDCY Q P+G +L    + +S+
Sbjct:  298 LGVGYGNNLDCYSQTPFGNSLFLSDLVTSQ 327          
BLAST of FC928881 vs. ExPASy Swiss-Prot
Match: CHI2_TOBAC (Endochitinase B OS=Nicotiana tabacum GN=CHN50 PE=1 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 4.629e-26
Identity = 45/86 (52.33%), Postives = 62/86 (72.09%), Query Frame = 1
Query:    1 IATDPVLSFKSTLWFWMTAPPPIPSCRELLIDEWKPSSNDVDPRRLPGYGQTTNIVNGGIECGQRGNAAVHNRIGYFTTFCGKFGI 258
            +ATDPV+SFKS LWFWMT   P PSC +++I  W+PSS D    RLPG+G  TNI+NGG+ECG+  ++ V +RIG++  +C   G+
Sbjct:  216 VATDPVISFKSALWFWMTPQSPKPSCHDVIIGRWQPSSADRAANRLPGFGVITNIINGGLECGRGTDSRVQDRIGFYRRYCSILGV 301          

HSP 2 Score: 30.0314 bits (66), Expect = 4.629e-26
Identity = 13/26 (50.00%), Postives = 17/26 (65.38%), Query Frame = 2
Query:  251 LGFSTGDSLDCYYQRPYGINLMAQSM 328
            LG S GD+LDC  QR +G  L+  +M
Sbjct:  299 LGVSPGDNLDCGNQRSFGNGLLVDTM 324          
BLAST of FC928881 vs. ExPASy Swiss-Prot
Match: CHIT_CARPA (Endochitinase OS=Carica papaya PE=1 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 4.658e-26
Identity = 45/86 (52.33%), Postives = 60/86 (69.77%), Query Frame = 1
Query:    1 IATDPVLSFKSTLWFWMTAPPPIPSCRELLIDEWKPSSNDVDPRRLPGYGQTTNIVNGGIECGQRGNAAVHNRIGYFTTFCGKFGI 258
            +ATD VLSFK+ LWFWMT   P PSC ++L   W+PS+ D    RLPGYG  TN++NGG+ECG+  N  V +R+G+F  +CG  G+
Sbjct:  143 VATDRVLSFKTALWFWMTPQAPKPSCHDVLTGRWQPSAADTAAGRLPGYGVLTNLLNGGLECGKGPNPQVADRLGFFRRYCGLLGV 228          

HSP 2 Score: 32.3426 bits (72), Expect = 4.658e-26
Identity = 12/18 (66.67%), Postives = 15/18 (83.33%), Query Frame = 2
Query:  251 LGFSTGDSLDCYYQRPYG 304
            LG  TG++LDCY QRP+G
Sbjct:  226 LGVGTGNNLDCYNQRPFG 243          
BLAST of FC928881 vs. ExPASy Swiss-Prot
Match: CHI1_TOBAC (Endochitinase A OS=Nicotiana tabacum GN=CHN48 PE=1 SV=2)

HSP 1 Score: 108.997 bits (271), Expect = 6.023e-26
Identity = 44/86 (51.16%), Postives = 62/86 (72.09%), Query Frame = 1
Query:    1 IATDPVLSFKSTLWFWMTAPPPIPSCRELLIDEWKPSSNDVDPRRLPGYGQTTNIVNGGIECGQRGNAAVHNRIGYFTTFCGKFGI 258
            +ATDPV+SFKS LWFWMT   P PSC +++I  W+PS+ D    RLPG+G  TNI+NGG+ECG+  ++ V +RIG++  +C   G+
Sbjct:  221 VATDPVISFKSALWFWMTPQSPKPSCHDVIIGRWQPSAGDRAANRLPGFGVITNIINGGLECGRGTDSRVQDRIGFYRRYCSILGV 306          

HSP 2 Score: 30.0314 bits (66), Expect = 6.023e-26
Identity = 13/26 (50.00%), Postives = 17/26 (65.38%), Query Frame = 2
Query:  251 LGFSTGDSLDCYYQRPYGINLMAQSM 328
            LG S GD+LDC  QR +G  L+  +M
Sbjct:  304 LGVSPGDNLDCGNQRSFGNGLLVDTM 329          
BLAST of FC928881 vs. ExPASy Swiss-Prot
Match: CHIB_POPTR (Acidic endochitinase WIN6.2B OS=Populus trichocarpa PE=2 SV=2)

HSP 1 Score: 105.531 bits (262), Expect = 7.854e-26
Identity = 45/86 (52.33%), Postives = 59/86 (68.60%), Query Frame = 1
Query:    1 IATDPVLSFKSTLWFWMTAPPPIPSCRELLIDEWKPSSNDVDPRRLPGYGQTTNIVNGGIECGQRG-NAAVHNRIGYFTTFCGKFG 255
            + TDP ++FK+ LWFWMT   P PSC  ++ + W PS+ D +  R+PGYG  TNI+NGGIECGQ G N A  NRIG++ T+C   G
Sbjct:  192 VETDPFIAFKTALWFWMTPQSPKPSCHAVITESWTPSAADSEAGRVPGYGVITNIINGGIECGQGGPNNANENRIGFYKTYCDSLG 277          

HSP 2 Score: 33.113 bits (74), Expect = 7.854e-26
Identity = 13/23 (56.52%), Postives = 17/23 (73.91%), Query Frame = 2
Query:  248 SLGFSTGDSLDCYYQRPYGINLM 316
            SLG + G +LDCY QRP+G  L+
Sbjct:  275 SLGTTYGSNLDCYQQRPFGYGLL 297          
BLAST of FC928881 vs. ExPASy Swiss-Prot
Match: CHI1_GOSHI (Endochitinase 1 OS=Gossypium hirsutum PE=3 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 2.251e-25
Identity = 43/88 (48.86%), Postives = 60/88 (68.18%), Query Frame = 1
Query:    1 IATDPVLSFKSTLWFWMTAPPPIPSCRELLIDEWKPSSNDVDPRRLPGYGQTTNIVNGGIECGQRGNAAVHNRIGYFTTFCGKFGIQH 264
            +++DP +SFKS  WFWMT   P PSC  ++I  W PSS+D    R+PGYG  TNI+NGG+ECG+  NA V +RIG++  +C   G+ +
Sbjct:  216 LSSDPTISFKSAFWFWMTPQSPKPSCHNVIIGAWSPSSSDRAAGRVPGYGVITNIINGGLECGKGWNAQVEDRIGFYKRYCDILGVSY 303          

HSP 2 Score: 31.187 bits (69), Expect = 2.251e-25
Identity = 13/26 (50.00%), Postives = 17/26 (65.38%), Query Frame = 2
Query:  251 LGFSTGDSLDCYYQRPYGINLMAQSM 328
            LG S G++LDCY Q P+G  +   SM
Sbjct:  299 LGVSYGNNLDCYNQSPFGNGVSVDSM 324          
BLAST of FC928881 vs. ExPASy Swiss-Prot
Match: CHI6_POPTR (Acidic endochitinase WIN6 OS=Populus trichocarpa GN=WIN6 PE=2 SV=2)

HSP 1 Score: 103.605 bits (257), Expect = 4.957e-25
Identity = 44/86 (51.16%), Postives = 59/86 (68.60%), Query Frame = 1
Query:    1 IATDPVLSFKSTLWFWMTAPPPIPSCRELLIDEWKPSSNDVDPRRLPGYGQTTNIVNGGIECGQRG-NAAVHNRIGYFTTFCGKFG 255
            + TDPV+SFK+ +WFWM    P PSC  ++   W PS+ D++  R+PGYG  TNI+NGGIECGQ G NAA  +RIG++  +C   G
Sbjct:  229 VETDPVISFKTAIWFWMKPQSPKPSCHAVITGNWTPSAADLEAGRVPGYGVITNIINGGIECGQGGPNAANEDRIGFYKKYCDSLG 314          

HSP 2 Score: 32.3426 bits (72), Expect = 4.957e-25
Identity = 13/22 (59.09%), Postives = 16/22 (72.73%), Query Frame = 2
Query:  248 SLGFSTGDSLDCYYQRPYGINL 313
            SLG + G +LDCY QRP+G  L
Sbjct:  312 SLGTTYGSNLDCYQQRPFGYGL 333          
BLAST of FC928881 vs. ExPASy Swiss-Prot
Match: CHI9_ORYSJ (Chitinase 9 OS=Oryza sativa subsp. japonica GN=Cht9 PE=2 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 1.093e-24
Identity = 44/86 (51.16%), Postives = 60/86 (69.77%), Query Frame = 1
Query:    1 IATDPVLSFKSTLWFWMTAPPPIPSCRELLIDEWKPSSNDVDPRRLPGYGQTTNIVNGGIECGQRGNAAVHNRIGYFTTFCGKFGI 258
            +A+DPV+SFK+ LWFWMT   P PSC +++  +W PSS D+   R+PGYG  TNI+NGG+ECG   +  V NRIG++  +C   GI
Sbjct:  227 VASDPVVSFKTALWFWMTPQSPKPSCHDVITGQWTPSSGDIAAGRVPGYGVITNIINGGLECGFGPDDRVANRIGFYQRYCDVLGI 312          

HSP 2 Score: 28.8758 bits (63), Expect = 1.093e-24
Identity = 12/23 (52.17%), Postives = 14/23 (60.87%), Query Frame = 2
Query:  251 LGFSTGDSLDCYYQRPYGINLMA 319
            LG   G +LDCY QRP+   L A
Sbjct:  310 LGIGYGSNLDCYDQRPFNSGLTA 332          
The following BLAST results are available for this feature:
BLAST of FC928881 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 45
Match NameE-valueIdentityDescription
CHI2_PEA1.613e-2653.49Endochitinase A2 OS=Pisum sativum GN=CHI2 PE=1 SV=... [more]
CHIT_PHAVU2.731e-2654.65Endochitinase OS=Phaseolus vulgaris PE=1 SV=1[more]
CHI5_PHAVU4.628e-2654.65Endochitinase CH5B OS=Phaseolus vulgaris PE=3 SV=1[more]
CHI2_TOBAC4.629e-2652.33Endochitinase B OS=Nicotiana tabacum GN=CHN50 PE=1... [more]
CHIT_CARPA4.658e-2652.33Endochitinase OS=Carica papaya PE=1 SV=1[more]
CHI1_TOBAC6.023e-2651.16Endochitinase A OS=Nicotiana tabacum GN=CHN48 PE=1... [more]
CHIB_POPTR7.854e-2652.33Acidic endochitinase WIN6.2B OS=Populus trichocarp... [more]
CHI1_GOSHI2.251e-2548.86Endochitinase 1 OS=Gossypium hirsutum PE=3 SV=1[more]
CHI6_POPTR4.957e-2551.16Acidic endochitinase WIN6 OS=Populus trichocarpa G... [more]
CHI9_ORYSJ1.093e-2451.16Chitinase 9 OS=Oryza sativa subsp. japonica GN=Cht... [more]

Pages

back to top
Libraries
Library NameType
PhII-IIIV1cdna_library
Properties
Property NameValue
Genbank descriptionKN0AAH1CC12RM2 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH1CC12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC928881 ID=FC928881|Name=FC928881|organism=Citrus clementina|type=EST|length=512bp
ATTGCTACTGATCCAGTACTATCATTCAAGTCCACACTCTGGTTCTGGAT
GACTGCTCCCCCCCCGATTCCATCATGCCGCGAACTCCTTATCGACGAAT
GGAAACCATCATCAAATGACGTAGACCCCCGCCGGCTTCCGGGATACGGT
CAAACCACAAATATAGTCAACGGTGGAATTGAATGTGGCCAACGTGGGAA
TGCAGCTGTACATAACCGTATTGGGTACTTTACCACTTTCTGTGGCAAGT
TTGGGATTCAGCACTGGTGACAGTCTTGATTGCTACTACCAACGACCTTA
TGGCATTAATCTGATGGCACAATCTATGTGATCATCAAGATCAACGTTTT
AATAAAATAATCTTAATAAAAGCTACTTAATAAAAACTTTAGATGTCACA
CTTGTAAGTGGACAACTAAATTGTTAGTTTGTTACGCTCTTATTGTAAGT
AAATTAAATAAGACTGATCCAACATGGATCAATGAGTCTTCACCAAAAAA
AAAAAAAAAAAA
back to top