FC928890

Overview
NameFC928890
Unique NameFC928890
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length779
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15010 contig Ccv1_Contig15010:1..779. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC928890 vs. ExPASy Swiss-Prot
Match: SYQ_LUPLU (Glutaminyl-tRNA synthetase OS=Lupinus luteus PE=2 SV=2)

HSP 1 Score: 282.337 bits (721), Expect = 1.988e-75
Identity = 135/186 (72.58%), Postives = 164/186 (88.17%), Query Frame = 2
Query:  167 SKGDKSEILELFLKIGLDDRTAKNTIANNKVTANLTAVIHEAAVTDGCERRIGNLLYTVATKYPTNALVHRPTLLRYIVSSKIKTPAQLEAAFSFFASTGSENFEVDEFEEACGVGVEVSSEDIELTVNEVFEENKNTILELRYRTNVGDLFAHVRKRLPWAEPKIVKQLIDARMYELLGERTAAD 724
            +  DK + LELFLKIGLD+RTAKNT+ANNKVT NLT+VI++A VTDGC R +GNLLYTVATKYP NAL HRPTLL+YIV+SK+KT AQL+AA SF ++TGSEN ++++FEEACGVGVEVS+EDI+  V+EV EENK TILELRYR NVG+L  HVRKRLPWA+ K+VKQL+DA++YE+LG+RTAAD
Sbjct:    7 TSSDKEKSLELFLKIGLDERTAKNTVANNKVTTNLTSVINDAGVTDGCSRTVGNLLYTVATKYPANALPHRPTLLQYIVNSKVKTTAQLDAALSFLSATGSENLDLNKFEEACGVGVEVSTEDIKHAVDEVVEENKATILELRYRVNVGELLGHVRKRLPWADAKVVKQLVDAKLYEILGDRTAAD 192          
BLAST of FC928890 vs. ExPASy Swiss-Prot
Match: SYQ_DICDI (Probable glutaminyl-tRNA synthetase OS=Dictyostelium discoideum GN=glnS PE=2 SV=2)

HSP 1 Score: 157.532 bits (397), Expect = 7.385e-38
Identity = 75/183 (40.98%), Postives = 112/183 (61.20%), Query Frame = 2
Query:  176 DKSEILELFLKIGLDDRTAKNTIANNKVTANLTAVIHEAAVTDGCERRIGNLLYTVATKYPTNALVHRPTLLRYIVSSKIKTPAQLEAAFSFFASTGSENFEVDEFEEACGVGVEVSSEDIELTVNEVFEENKNTILELRYRTNVGDLFAHVRKRLPWAEPKIVKQLIDARMYELLGERTAAD 724
            +K E++ LF +IGLD   AK T  N  +++NL  +I EA    GCE+ +G LLYT+ATKYP NA+ HR TL+ YI + K      L+A   +   T +E   V EFE++CGVGV ++ E +   V++   +NK+ +LE RY+ N+G +   ++  L WA  K +K+ +DA +  LLG +T AD
Sbjct:    8 NKDELVTLFSQIGLDSSKAKETTNNATLSSNLQEIIKEAGAESGCEKSVGLLLYTLATKYPANAMKHRATLVDYIANKKSVNSINLQACLDYLRRTANEELNVAEFEQSCGVGVVITREQVAQAVSDYINKNKSDLLEKRYQFNIGGILMEIKNSLKWANAKDIKEEVDAAILSLLGPKTDAD 190          
BLAST of FC928890 vs. ExPASy Swiss-Prot
Match: SYQ_CAEEL (Probable glutaminyl-tRNA synthetase OS=Caenorhabditis elegans GN=ers-1 PE=3 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 1.182e-27
Identity = 64/178 (35.96%), Postives = 100/178 (56.18%), Query Frame = 2
Query:  194 ELFLKIGLDDRTAKNTIANNKVTANLTAVIHEAAVTDGCERRIGNLLYTVATKYPTNALVHRPTLLRYIVSSKIKTPAQLEAAFSFFASTGSENFEVDEFEEACGVGVEVSSEDIELTVNEVFEENKNTILELRYRTNVGDLFAHVRKRLPWAEPKIVKQLIDARMYELLGERTAADI 727
            E  L +GL D     T+ N K+T  + +++  A+ +    ++ G LLY +ATK       H P +++YI++  IKT  QL AA  +  S   +  +V +FE++CGVGV V+ +DIE  V +V  +++  I+  RY    G L   +R  LPWA+  I K+ +D R  ELLG +TA D+
Sbjct:    5 EELLSLGLSDSKVAETLKNVKLTETIGSIVKLASESGEISKQKGTLLYQLATKLKPQVAAHTPLVVKYIMNDGIKTEPQLSAAIEYLLSHTVKGIQVPDFEKSCGVGVVVTIDDIEAAVTKVIGQHREKIVAERYSFPAGKLLGELRALLPWADGAITKKEVDLRFLELLGPKTAEDL 182          
BLAST of FC928890 vs. ExPASy Swiss-Prot
Match: SYNC_DICDI (Asparaginyl-tRNA synthetase, cytoplasmic OS=Dictyostelium discoideum GN=asnS1 PE=1 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 1.706e-26
Identity = 63/173 (36.42%), Postives = 105/173 (60.69%), Query Frame = 2
Query:  194 ELFLKIGLDDRTAKNTIANNKVTANLTAVIHEAAVTDGCERRIGNLLYTVATKYPTNALVHRPTLLRYIVSSKIKTPAQLEAAFSFFASTGSENFEVDEFEEACGVGVEVSSEDIELTVNEVFEENKNTILELRYRTNVGDLFAHVRKRLPWAEPKIVKQLIDARMYELLGER 712
            +LFL IGLD++ AK+T+ N  +TA L  +I EA+V+ GC++ IGNLLY++AT    N+ + R  + + I   KIKT  Q +AA  +     ++ F  D F + CGVGV ++ E I+  ++++F +    I E ++   +GDL   +++ L WA+ K VK ++D ++   LG +
Sbjct:    8 KLFLSIGLDEKRAKDTLKNKDLTALLKTIIEEASVSKGCDKSIGNLLYSLATCQQVNSPI-RSNVSKAIGEEKIKTTIQFQAATQYLKD--NKEFNQDTFNDFCGVGVVITPEQIQKAIDDLFTKKATEISEKKWHIPIGDLLNPLKESLKWADLKEVKIMLDKKLETTLGPK 177          
BLAST of FC928890 vs. ExPASy Swiss-Prot
Match: SYQ_DROME (Probable glutaminyl-tRNA synthetase OS=Drosophila melanogaster GN=Aats-gln PE=1 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 5.138e-23
Identity = 66/188 (35.11%), Postives = 98/188 (52.13%), Query Frame = 2
Query:  185 EILELFLKIGLDDRTAKNTIANNKVTANLT---AVIHEAAVTDGCERRIGNLLYTVATKYPTNALVHRPTLLRYIVSSKIKTPAQLEAAFSFFASTGSE---NFEVDEFEEACGVGVEVSSEDIELTVNEVFEEN-KNTILELRYRTNVGDLFAHVRKRLPWAEPKIVKQLIDARMYELLGERTAADI 727
            +++  F  +G+ ++ AK T+ N  VT NL    A    A ++DG     G L+Y +ATK       H P L+RYIV  K+    +++AA  +    G     N ++   E+ CGVGV V+ E IE TV    + + K  +LE RY  N   +   VR  L WA+ K VK  ID  +++LLG +T AD+
Sbjct:    5 DLIAKFQALGMSEQKAKETLKNANVTKNLQLSLAAAGSATLSDGT----GMLIYHMATKLKPQTADHLPLLVRYIVEHKLDNTQRVDAALEYLLKCGQSLNANIDLQALEKECGVGVVVTPEQIERTVQAKIKASYKEALLEQRYHFNSFKILQDVRGELKWADAKSVKAAIDVEIFDLLGPKTEADL 188          
BLAST of FC928890 vs. ExPASy Swiss-Prot
Match: SYQ_SCHPO (Probable glutaminyl-tRNA synthetase OS=Schizosaccharomyces pombe GN=SPBC342.02 PE=2 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 4.350e-22
Identity = 68/189 (35.98%), Postives = 100/189 (52.91%), Query Frame = 2
Query:  176 DKSEILELFLKIGLDDRTAKNTIANNKVTANLTAVIHEAAV-TDGCERRIGNLLYTVAT----KYPTNALVHRPTLLRYIVSSKIKTPAQLEAAFSFFASTGSENFEVDEFEEACGVGVEVSSEDIELTVNEVFEENKNTILELRYR-TNVGDLFAHVRKRLPWAEPKIVKQLIDARMYELLGERTAAD 724
            D  E+   F KIGL++ T K+T+ N K++++L  VI E  V + GC+R IGNLL+T+A     +    +  H   +   IVS  +KT  Q+ AA ++      +  +  EF++  GVGV ++ E IE  V +   ENK+ ILE RY+  N           L WA    VKQ +D +  ELLG +T  D
Sbjct:    4 DYEELRAKFTKIGLNETTVKDTLKNKKLSSSLNKVIEETNVGSSGCDRTIGNLLFTLANASLKQKDPKSNAHEAFIASKIVSGDLKTNLQVNAAITYCKD--KDTIDESEFDKETGVGVVLTPEQIEQLVGDYVAENKSKILEQRYQLLNPSASALRQHALLKWAPQLEVKQTLDRKFLELLGPKTEQD 190          
BLAST of FC928890 vs. ExPASy Swiss-Prot
Match: SYQ_BOVIN (Glutaminyl-tRNA synthetase OS=Bos taurus GN=QARS PE=2 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 9.070e-20
Identity = 59/181 (32.60%), Postives = 93/181 (51.38%), Query Frame = 2
Query:  191 LELFLKIGLDDRTAKNTIANNKVTANLTAVIHEAAVTDGC--ERRIGNLLYTVATKYPTNALVHRPTLLRYIVSSKIKTPAQLEAAFSFFASTGSENFEVDEFEEACGVGVEVSSEDIELTVNEVFEENKNTILELRYRTNVGDLFAHVRKRLPWAEPKIVKQLIDARMYELLGERTAADI 727
            L LF  +GL ++ A+ T+ N  ++A L     +A  T G   ++  G LLY +A++      +    L+ YI S KI T  QL AA  +  S   +    ++FE+ CGVGV V+ E IE  V      ++  +L  RY  ++G L    R  L WA+ K++K  +D ++  LLG +T  D+
Sbjct:    7 LSLFTGLGLSEQKARETLKNTVLSAQLREAATQAQQTLGSSIDKATGTLLYGLASRLRDPRRLS--FLVSYITSRKIHTETQLSAALEYVRSHPLDPINTEDFEQECGVGVVVTPEQIEEAVEAAINRHRAKLLVERYHFSMGLLMGEARAALKWADGKMIKHEVDMQVLHLLGPKTETDL 185          
BLAST of FC928890 vs. ExPASy Swiss-Prot
Match: SYQ_HUMAN (Glutaminyl-tRNA synthetase OS=Homo sapiens GN=QARS PE=1 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 1.547e-19
Identity = 60/181 (33.15%), Postives = 93/181 (51.38%), Query Frame = 2
Query:  191 LELFLKIGLDDRTAKNTIANNKVTANLTAVIHEAAVTDGC--ERRIGNLLYTVATKYPTNALVHRPTLLRYIVSSKIKTPAQLEAAFSFFASTGSENFEVDEFEEACGVGVEVSSEDIELTVNEVFEENKNTILELRYRTNVGDLFAHVRKRLPWAEPKIVKQLIDARMYELLGERTAADI 727
            L LF  +GL ++ A+ T+ N+ ++A L     +A  T G   ++  G LLY +A++      +    L+ YI S KI T  QL AA  +  S   +  +  +FE  CGVGV V+ E IE  V      ++  +L  RY  N+G L    R  L WA+ K++K  +D ++  LLG +  AD+
Sbjct:    7 LSLFTSLGLSEQKARETLKNSALSAQLREAATQAQQTLGSTIDKATGILLYGLASRLRDTRRLS--FLVSYIASKKIHTEPQLSAALEYVRSHPLDPIDTVDFERECGVGVIVTPEQIEEAVEAAINRHRPQLLVERYHFNMGLLMGEARAVLKWADGKMIKNEVDMQVLHLLGPKLEADL 185          
BLAST of FC928890 vs. ExPASy Swiss-Prot
Match: SYQ_YEAST (Glutaminyl-tRNA synthetase OS=Saccharomyces cerevisiae GN=GLN4 PE=1 SV=2)

HSP 1 Score: 87.0409 bits (214), Expect = 1.226e-16
Identity = 52/183 (28.42%), Postives = 96/183 (52.46%), Query Frame = 2
Query:  185 EILELFLKIGLDDRTAKNTIANNKVTANLTAVIHEAAVTDGCERRIGNLLYTVATKYPTNALVHRPTLLRYIVSSKIKTPAQLEAAFSFFASTGSENFEVDEFEEACGVGVEVSSEDIELTVNEVFEENKNTILELRYRTNVGDLFAHVR--KRLPWAEPKIVKQLIDARMYELLGERTAADI 727
            E+ +LF ++G +D+  K  + N KV+ +L  +I E        +    L++ +A+      L     ++  I++  +KT  Q++AAF +  + G  + ++    E  GVG+E++ + +   V +  +ENK  IL  RY+  V  +FA V+  K L WA+P+  K +ID  + +LLG +   D+
Sbjct:    6 ELTQLFSQVGFEDKKVKEIVKNKKVSDSLYKLIKETPSDYQWNKSTRALVHNLASFVKGTDLPKSELIVNGIINGDLKTSLQVDAAFKYVKANGEASTKMG-MNENSGVGIEITEDQVRNYVMQYIQENKERILTERYKL-VPGIFADVKNLKELKWADPRSFKPIIDQEVLKLLGPKDERDL 186          
The following BLAST results are available for this feature:
BLAST of FC928890 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 9
Match NameE-valueIdentityDescription
SYQ_LUPLU1.988e-7572.58Glutaminyl-tRNA synthetase OS=Lupinus luteus PE=2 ... [more]
SYQ_DICDI7.385e-3840.98Probable glutaminyl-tRNA synthetase OS=Dictyosteli... [more]
SYQ_CAEEL1.182e-2735.96Probable glutaminyl-tRNA synthetase OS=Caenorhabdi... [more]
SYNC_DICDI1.706e-2636.42Asparaginyl-tRNA synthetase, cytoplasmic OS=Dictyo... [more]
SYQ_DROME5.138e-2335.11Probable glutaminyl-tRNA synthetase OS=Drosophila ... [more]
SYQ_SCHPO4.350e-2235.98Probable glutaminyl-tRNA synthetase OS=Schizosacch... [more]
SYQ_BOVIN9.070e-2032.60Glutaminyl-tRNA synthetase OS=Bos taurus GN=QARS P... [more]
SYQ_HUMAN1.547e-1933.15Glutaminyl-tRNA synthetase OS=Homo sapiens GN=QARS... [more]
SYQ_YEAST1.226e-1628.42Glutaminyl-tRNA synthetase OS=Saccharomyces cerevi... [more]
back to top
Properties
Property NameValue
Genbank descriptionKN0AAH1CD10RM2 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH1CD10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC928890 ID=FC928890|Name=FC928890|organism=Citrus clementina|type=EST|length=779bp
GAAAAACGCACGCACCCTGATTCGTGATTCCTTATTAACAATCCTCTTCT
ACAATTACTTTACTAGGGTTTTAAAGCCCACGCATTCTTCAGGCACCTCC
TCACTCTCCTCCCCCCACGCCCTAAAACGATACCGTAGAGCCGCTGAAAC
AACAATGGTTGGGGTTTCTAAGGGCGACAAATCGGAAATCCTGGAGCTGT
TCTTAAAAATCGGCCTCGACGATCGAACGGCCAAAAACACAATTGCTAAT
AACAAAGTTACCGCCAATCTGACTGCCGTCATTCATGAGGCCGCTGTCAC
CGACGGATGTGAACGAAGGATTGGGAATTTGCTTTACACGGTTGCTACGA
AGTACCCGACAAACGCACTTGTACATCGTCCAACTTTGCTGCGGTACATT
GTCTCCTCAAAGATTAAAACCCCAGCCCAGTTAGAAGCAGCATTCTCATT
TTTTGCGAGTACTGGTTCAGAAAATTTTGAAGTGGATGAATTTGAAGAAG
CCTGCGGTGTTGGGGTTGAAGTTTCCTCGGAAGATATCGAACTGACTGTT
AATGAAGTATTTGAAGAGAACAAGAACACGATTTTAGAGCTACGTTATCG
AACTAATGTGGGTGATTTGTTTGCACATGTCCGGAAGAGGCTTCCATGGG
CTGAGCCCAAGATTGTCAAGCAACTCATAGATGCTAGAATGTATGAATTA
CTTGGTGAAAGGACAGCAGCAGATATTGAGAAGCTTTCTAAAAAGAAGGA
GAAGAAGGAGAAGAANGAAAAGCCTGAAA
back to top