FC928898

Overview
NameFC928898
Unique NameFC928898
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length817
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15012 contig Ccv1_Contig15012:1..817. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC928898 vs. ExPASy Swiss-Prot
Match: UFOG_VITVI (Anthocyanidin 3-O-glucosyltransferase 2 OS=Vitis vinifera GN=UFGT PE=1 SV=2)

HSP 1 Score: 266.929 bits (681), Expect = 1.196e-77
Identity = 131/218 (60.09%), Postives = 166/218 (76.15%), Query Frame = 1
Query:    1 GMNKIRVADLPEGVVSGDLDSVFSVMLHQMGRQLPKAAAVFINSFEELDPELTNHLKTKFNNKFLSVGPFKLLLASDQQPSSATDLDDEYGCLAWLDKQKKKPASVAYVSFGTVATPSPNEIVAIAEALEASKVPFIWSLRHRSQANLPNGFLERTRSDGIVVDWATQVNVLAHEAVGVFVTHCGWGSILESIAAGVPMIGRPFFGDQRINGRMMEQI 654
            GM+K+R  DL EG+V G+L+S+FS MLH+MG+ LPKA AVFINSFEELD  LTN LK+K    +L++GPF L+      P++        GCL WL  +++KP SV Y+SFGTV TP P E+VA++EALEAS+VPFIWSLR +++ +LP GFLE+TR  G+VV WA Q  VLAHEAVG FVTHCGW S+ ES+A GVP+I RPFFGDQR+NGRM+E +
Sbjct:  178 GMSKVRFRDLQEGIVFGNLNSLFSRMLHRMGQVLPKATAVFINSFEELDDSLTNDLKSKLKT-YLNIGPFNLITPPPVVPNTT-------GCLQWL--KERKPTSVVYISFGTVTTPPPAEVVALSEALEASRVPFIWSLRDKARVHLPEGFLEKTRGYGMVVPWAPQAEVLAHEAVGAFVTHCGWNSLWESVAGGVPLICRPFFGDQRLNGRMVEDV 385          

HSP 2 Score: 45.0542 bits (105), Expect = 1.196e-77
Identity = 21/41 (51.22%), Postives = 27/41 (65.85%), Query Frame = 2
Query:  695 TKEGLLSSLDLILCQEKGIKIREKVTKLKQLCQNAIGPGGS 817
            TK GL+S  D IL QEKG K+RE +  L++    A+GP GS
Sbjct:  398 TKSGLMSCFDQILSQEKGKKLRENLRALRETADRAVGPKGS 438          
BLAST of FC928898 vs. ExPASy Swiss-Prot
Match: UFOG7_MANES (Anthocyanidin 3-O-glucosyltransferase 7 (Fragment) OS=Manihot esculenta GN=GT7 PE=2 SV=1)

HSP 1 Score: 288.886 bits (738), Expect = 2.316e-77
Identity = 141/218 (64.68%), Postives = 174/218 (79.82%), Query Frame = 1
Query:    1 GMNKIRVADLPEGVVSGDLDSVFSVMLHQMGRQLPKAAAVFINSFEELDPELTNHLKTKFNNKFLSVGPFKLLLASDQQPSSATDLDDEYGCLAWLDKQKKKPASVAYVSFGTVATPSPNEIVAIAEALEASKVPFIWSLRHRSQANLPNGFLERTRSDGIVVDWATQVNVLAHEAVGVFVTHCGWGSILESIAAGVPMIGRPFFGDQRINGRMMEQI 654
            GM+KI++ DLPEGV+ G+L+S+FS MLH MGR LP+AAAV +NSFEELDP + + L +KFNN  L +GPF L+       S    + D YGC+AWLDKQK  PASVAY+SFG+VATP P+E+VA+AEALEASKVPF+WSL+  S+ +LPNGFL+RT+S GIV+ WA QV +L H A+GVFVTHCGW SILESI  GVPMI RPFFGDQR+NGRM+E +
Sbjct:    7 GMSKIQIRDLPEGVLFGNLESLFSQMLHNMGRMLPRAAAVLMNSFEELDPTIVSDLNSKFNN-ILCIGPFNLV-------SPPPPVPDTYGCMAWLDKQK--PASVAYISFGSVATPPPHELVALAEALEASKVPFLWSLKDHSKVHLPNGFLDRTKSHGIVLSWAPQVEILEHAALGVFVTHCGWNSILESIVGGVPMICRPFFGDQRLNGRMVEDV 214          
BLAST of FC928898 vs. ExPASy Swiss-Prot
Match: UGFGT_ARATH (Flavonoid 3-O-glucosyltransferase OS=Arabidopsis thaliana GN=UGT78D2 PE=2 SV=1)

HSP 1 Score: 276.174 bits (705), Expect = 2.897e-76
Identity = 136/218 (62.39%), Postives = 168/218 (77.06%), Query Frame = 1
Query:    1 GMNKIRVADLPEGVVSGDLDSVFSVMLHQMGRQLPKAAAVFINSFEELDPELTNHLKTKFNNKFLSVGPFKLLLASDQQPSSATDLDDEYGCLAWLDKQKKKPASVAYVSFGTVATPSPNEIVAIAEALEASKVPFIWSLRHRSQANLPNGFLERTRSDGIVVDWATQVNVLAHEAVGVFVTHCGWGSILESIAAGVPMIGRPFFGDQRINGRMMEQI 654
            GM KIRV D PEGVV G+LDSVFS MLHQMG  LP+A AVFINSFE+LDP LTN+L+++F  ++L++GP  LL ++ QQ      + D +GCLAW++K+     SVAY+SFGTV TP P E+ AIAE LE+SKVPF+WSL+ +S   LP GFL+RTR  GIVV WA QV +L HEA GVFVTHCGW S+LES++ GVPMI RPFFGDQR+NGR +E +
Sbjct:  182 GMEKIRVKDTPEGVVFGNLDSVFSKMLHQMGLALPRATAVFINSFEDLDPTLTNNLRSRFK-RYLNIGPLGLLSSTLQQL-----VQDPHGCLAWMEKRSS--GSVAYISFGTVMTPPPGELAAIAEGLESSKVPFVWSLKEKSLVQLPKGFLDRTREQGIVVPWAPQVELLKHEATGVFVTHCGWNSVLESVSGGVPMICRPFFGDQRLNGRAVEVV 391          

HSP 2 Score: 31.187 bits (69), Expect = 2.897e-76
Identity = 15/40 (37.50%), Postives = 22/40 (55.00%), Query Frame = 2
Query:  695 TKEGLLSSLDLILCQEKGIKIREKVTKLKQLCQNAIGPGG 814
            TK+G    LD +L Q+ G K++    KLK+L   A+   G
Sbjct:  404 TKDGFEKCLDKVLVQDDGKKMKCNAKKLKELAYEAVSSKG 443          
BLAST of FC928898 vs. ExPASy Swiss-Prot
Match: KGLT_PETHY (Kaempferol 3-O-beta-D-galactosyltransferase OS=Petunia hybrida PE=1 SV=1)

HSP 1 Score: 260.766 bits (665), Expect = 1.700e-73
Identity = 128/218 (58.72%), Postives = 163/218 (74.77%), Query Frame = 1
Query:    1 GMNKIRVADLPEGVVSGDLDSVFSVMLHQMGRQLPKAAAVFINSFEELDPELTNHLKTKFNNKFLSVGPFKLLLASDQQPSSATDLDDEYGCLAWLDKQKKKPASVAYVSFGTVATPSPNEIVAIAEALEASKVPFIWSLRHRSQANLPNGFLERTRSDGIVVDWATQVNVLAHEAVGVFVTHCGWGSILESIAAGVPMIGRPFFGDQRINGRMMEQI 654
            G  ++R+  LP GVVSGDL+S FSVMLH+MG+ + KA A+ +NSFEELDP +   LK+KFNN FL+VGPF L       P  + ++ DEYGC+AWLDKQ+  P SVAY+ FGTVATP PNE+ A+AEALE SK PF+WSL+   ++  P GFLERT   G +V WA QV VL+H +VGVF+ HCGW S+LESIAAGVP+I RPFFGD ++N  M+E++
Sbjct:  172 GFAELRLGSLPSGVVSGDLESPFSVMLHKMGKTIGKATALPVNSFEELDPPIVEDLKSKFNN-FLNVGPFNLTT-----PPPSANITDEYGCIAWLDKQE--PGSVAYIGFGTVATPPPNELKAMAEALEESKTPFLWSLKDLFKSFFPEGFLERTSEYGKIVSWAPQVQVLSHGSVGVFINHCGWNSVLESIAAGVPVICRPFFGDHQLNAWMVEKV 381          

HSP 2 Score: 37.3502 bits (85), Expect = 1.700e-73
Identity = 16/42 (38.10%), Postives = 30/42 (71.43%), Query Frame = 2
Query:  695 TKEGLLSSLDLILCQEK-GIKIREKVTKLKQLCQNAIGPGGS 817
            TK+G + +LDL+L ++K   ++++++   K+L  NA+GP GS
Sbjct:  394 TKDGTMLALDLVLSKDKRNTELKQQIGMYKELALNAVGPSGS 435          
BLAST of FC928898 vs. ExPASy Swiss-Prot
Match: FORT_ARATH (Flavonol-3-O-glucoside L-rhamnosyltransferase OS=Arabidopsis thaliana GN=UGT78D1 PE=2 SV=1)

HSP 1 Score: 241.891 bits (616), Expect = 2.381e-63
Identity = 119/218 (54.59%), Postives = 158/218 (72.48%), Query Frame = 1
Query:    1 GMNKIRVADLPEGVVSGDLDSVFSVMLHQMGRQLPKAAAVFINSFEELDPELTNHLKTKFNNKFLSVGPFKLLLASDQQPSSATDLDDEYGCLAWLDKQKKKPASVAYVSFGTVATPSPNEIVAIAEALEASKVPFIWSLRHRSQANLPNGFLERTRSDGIVVDWATQVNVLAHEAVGVFVTHCGWGSILESIAAGVPMIGRPFFGDQRINGRMMEQI 654
            GM   RV D+PE VV  DLDSVF   L+QM   LP+A+AVFI+SFEEL+P L  +L++K   +FL++ P  LL ++ ++     ++ D +GC AW+ K  +  ASVAY+SFGTV  P P E+VAIA+ LE+SKVPF+WSL+ ++  +LP GFL+RTR  GIVV WA QV +L HEA+GV VTHCGW S+LES++AGVPMIGRP   D R+NGR +E +
Sbjct:  176 GMENYRVKDIPEEVVFEDLDSVFPKALYQMSLALPRASAVFISSFEELEPTLNYNLRSKLK-RFLNIAPLTLLSSTSEK-----EMRDPHGCFAWMGK--RSAASVAYISFGTVMEPPPEELVAIAQGLESSKVPFVWSLKEKNMVHLPKGFLDRTREQGIVVPWAPQVELLKHEAMGVNVTHCGWNSVLESVSAGVPMIGRPILADNRLNGRAVEVV 385          

HSP 2 Score: 22.3274 bits (46), Expect = 2.381e-63
Identity = 12/41 (29.27%), Postives = 18/41 (43.90%), Query Frame = 2
Query:  695 TKEGLLSSLDLILCQEKGIKIREKVTKLKQLCQNAIGPGGS 817
            TKEG    L+ +   + G  ++    KLK+  Q      GS
Sbjct:  398 TKEGFEKCLNDVFVHDDGKTMKANAKKLKEKLQEDFSMKGS 438          
BLAST of FC928898 vs. ExPASy Swiss-Prot
Match: UFOG_SOLME (Anthocyanidin 3-O-glucosyltransferase OS=Solanum melongena GN=GT PE=2 SV=1)

HSP 1 Score: 213.772 bits (543), Expect = 1.054e-57
Identity = 115/215 (53.49%), Postives = 145/215 (67.44%), Query Frame = 1
Query:   13 IRVADLPEGVVSGDLDSVFSVMLHQMGRQLPKAAAVFINSFEELDPE-LTNHLKTKFNNKFLSVGPFKLLLASDQQPSSATDLDDEYGCLAWLDKQKKKPASVAYVSFGTVATPSPNEIVAIAEALEASKVPFIWSLRHRSQANLPNGFLERTRSDGIVVDWATQVNVLAHEAVGVFVTHCGWGSILESIAAGVPMIGRPFFGDQRINGRMMEQI 654
            + + D+P  V + DL+   S ML+ M   L KA AV +NSF+ELD + L N    K   K  ++GP  L+L S ++        DE GC+ WLDKQK+K  SV Y+SFGTV T  PNEI +IAEALE  K PFIWSLR+    NLP GFLERT+  G +V WA Q+ +LAH++VGVFVTHCGW SILE I+ GVPMI RPFFGDQ++N RM+E +
Sbjct:  169 LSINDIPPEVTAEDLEGPMSSMLYNMALNLHKADAVVLNSFQELDRDPLINKDLQKNLQKVFNIGP--LVLQSSRKL-------DESGCIQWLDKQKEK--SVVYLSFGTVTTLPPNEIGSIAEALETKKTPFIWSLRNNGVKNLPKGFLERTKEFGKIVSWAPQLEILAHKSVGVFVTHCGWNSILEGISFGVPMICRPFFGDQKLNSRMVESV 372          

HSP 2 Score: 31.5722 bits (70), Expect = 1.054e-57
Identity = 15/36 (41.67%), Postives = 22/36 (61.11%), Query Frame = 2
Query:  695 TKEGLLSSLDLILCQEKGIKIREKVTKLKQLCQNAI 802
            TK G++S+LD    +EKG  +RE V  LK+    A+
Sbjct:  385 TKSGIISALDTFFNEEKGKILRENVEGLKEKALEAV 420          
BLAST of FC928898 vs. ExPASy Swiss-Prot
Match: UGFGT_MEDTR (Flavonoid 3-O-glucosyltransferase OS=Medicago truncatula GN=UGT78G1 PE=1 SV=1)

HSP 1 Score: 211.846 bits (538), Expect = 1.791e-57
Identity = 107/218 (49.08%), Postives = 144/218 (66.06%), Query Frame = 1
Query:    1 GMNKIRVADLPEGVVSGDLDSVFSVMLHQMGRQLPKAAAVFINSFEELDPELTNHLKTKFNNKFLSVGPFKLLLASDQQPSSATDLDDEYGCLAWLDKQKKKPASVAYVSFGTVATPSPNEIVAIAEALEASKVPFIWSLRHRSQANLPNGFLERTRSDGIVVDWATQVNVLAHEAVGVFVTHCGWGSILESIAAGVPMIGRPFFGDQRINGRMMEQI 654
            G  +++ +DLPEGV+  D+D  F+ MLH+MG +LP+A AV INSF  + P + N L +KF    L+VGPF L     +       + DE+GCL WLD+ +   +SV Y+SFG+V TP P+E+ A+AE+LE    PFIWS R   +  LP GFLERT++ G +V WA QV +L H +VGVF+TH GW S+LE I  GVPMI RPFFGDQ +N  + E +
Sbjct:  181 GFPELKASDLPEGVIK-DIDVPFATMLHKMGLELPRANAVAINSFATIHPLIENELNSKFK-LLLNVGPFNLTTPQRK-------VSDEHGCLEWLDQHEN--SSVVYISFGSVVTPPPHELTALAESLEECGFPFIWSFRGDPKEKLPKGFLERTKTKGKIVAWAPQVEILKHSSVGVFLTHSGWNSVLECIVGGVPMISRPFFGDQGLNTILTESV 387          

HSP 2 Score: 32.7278 bits (73), Expect = 1.791e-57
Identity = 15/41 (36.59%), Postives = 25/41 (60.98%), Query Frame = 2
Query:  695 TKEGLLSSLDLILCQEKGIKIREKVTKLKQLCQNAIGPGGS 817
            TKE +  +L+L +  EKG  +R+K+ KLK+    A+   G+
Sbjct:  400 TKESIKKALELTMSSEKGGIMRQKIVKLKESAFKAVEQNGT 440          
BLAST of FC928898 vs. ExPASy Swiss-Prot
Match: UFOG_GENTR (Anthocyanidin 3-O-glucosyltransferase OS=Gentiana triflora PE=2 SV=1)

HSP 1 Score: 219.164 bits (557), Expect = 2.253e-56
Identity = 108/218 (49.54%), Postives = 150/218 (68.81%), Query Frame = 1
Query:    1 GMNKIRVADLPEGVVSGDLDSVFSVMLHQMGRQLPKAAAVFINSFEELDPELTNHLKTKFNNKFLSVGPFKLLLASDQQPSSATDLDDEYGCLAWLDKQKKKPASVAYVSFGTVATPSPNEIVAIAEALEASKVPFIWSLRHRSQANLPNGFLERTRSDGIVVDWATQVNVLAHEAVGVFVTHCGWGSILESIAAGVPMIGRPFFGDQRINGRMMEQI 654
            G++ I  +DLPE ++  D  S+F++ LH MG +L KA AV +NSFEE+DP +TNHL++      L++GP + L       SS    D+E  CL WL  QK+  +SV Y+SFGTV  P PNE+ A+A  LE+ K+PF+WSLR  ++ +LP  F++RT + G +V WA Q++VL + A+GVFVTHCGW S LESI   VP+IGRPFFGDQ++N RM+E +
Sbjct:  176 GLSAISFSDLPEELIMEDSQSIFALTLHNMGLKLHKATAVAVNSFEEIDPIITNHLRSTNQLNILNIGPLQTL------SSSIPPEDNE--CLKWLQTQKE--SSVVYLSFGTVINPPPNEMAALASTLESRKIPFLWSLRDEARKHLPENFIDRTSTFGKIVSWAPQLHVLENPAIGVFVTHCGWNSTLESIFCRVPVIGRPFFGDQKVNARMVEDV 383          
BLAST of FC928898 vs. ExPASy Swiss-Prot
Match: UFOG2_MAIZE (Anthocyanidin 3-O-glucosyltransferase OS=Zea mays GN=BZ1 PE=3 SV=1)

HSP 1 Score: 206.838 bits (525), Expect = 6.121e-55
Identity = 111/223 (49.78%), Postives = 144/223 (64.57%), Query Frame = 1
Query:    1 GMNKIRVADLPEGVVSGDLDSVFSVMLHQMGRQLPK-AAAVFINSFEELDPELTNHLKTKFNNKFLSVGPFKLLLASDQQPSSATDLDDEYGCLAWLDKQKKKPASVAYVSFGTVATPSPNEIVAIAEALEASKVPFIWSLRHRSQANLPNGFLERTRS--DGIVVDWATQVNVLAHEAVGVFVTHCGWGSILESIAAGVPMIGRPFFGDQRINGRMMEQIXG 660
            G+   RV DLP+GVVSGD + V S+++H+MG+ LP+ AAAV +N+F  LDP        +     +  GP+ LLLA D   ++A    D +GCLAWL +Q  +   VAYVSFGTVA P P+E+  +A  LEAS  PF+WSLR  S   LP GFL+R      G+VV WA QV VL H +VG FVTH GW S+LE +++GVPM  RPFFGDQR+N R +  + G
Sbjct:  188 GLASYRVRDLPDGVVSGDFNYVISLLVHRMGQCLPRSAAAVALNTFPGLDPPDVTAALAEILPNCVPFGPYHLLLAEDDADTAAPA--DPHGCLAWLGRQPAR--GVAYVSFGTVACPRPDELRELAAGLEASAAPFLWSLREDSWTLLPPGFLDRAAGTGSGLVVPWAPQVAVLRHPSVGAFVTHAGWASVLEGVSSGVPMACRPFFGDQRMNARSVAHVWG 406          

HSP 2 Score: 29.261 bits (64), Expect = 6.121e-55
Identity = 13/40 (32.50%), Postives = 24/40 (60.00%), Query Frame = 2
Query:  695 TKEGLLSSLDLILCQEKGIKIREKVTKLKQLCQNAIGPGG 814
            T  G+ ++++ +L  E+G  +R +  +L+ L   A GPGG
Sbjct:  416 TSAGVAAAVEELLRGEEGAGMRARAKELQALVAEAFGPGG 455          
BLAST of FC928898 vs. ExPASy Swiss-Prot
Match: UFOG3_MAIZE (Anthocyanidin 3-O-glucosyltransferase OS=Zea mays GN=BZ1 PE=3 SV=1)

HSP 1 Score: 205.297 bits (521), Expect = 1.356e-54
Identity = 110/223 (49.33%), Postives = 144/223 (64.57%), Query Frame = 1
Query:    1 GMNKIRVADLPEGVVSGDLDSVFSVMLHQMGRQLPK-AAAVFINSFEELDPELTNHLKTKFNNKFLSVGPFKLLLASDQQPSSATDLDDEYGCLAWLDKQKKKPASVAYVSFGTVATPSPNEIVAIAEALEASKVPFIWSLRHRSQANLPNGFLERTRS--DGIVVDWATQVNVLAHEAVGVFVTHCGWGSILESIAAGVPMIGRPFFGDQRINGRMMEQIXG 660
            G+   RV DLP+GVVSGD + V ++++H+MG+ LP+ AAAV +N+F  LDP        +     +  GP+ LLLA D   ++A    D +GCLAWL +Q  +   VAYVSFGTVA P P+E+  +A  LEAS  PF+WSLR  S   LP GFL+R      G+VV WA QV VL H +VG FVTH GW S+LE +++GVPM  RPFFGDQR+N R +  + G
Sbjct:  188 GLASYRVRDLPDGVVSGDFNYVINLLVHRMGQCLPRSAAAVALNTFPGLDPPDVTAALAEILPNCVPFGPYHLLLAEDDADTAAPA--DPHGCLAWLGRQPAR--GVAYVSFGTVACPRPDELRELAAGLEASGAPFLWSLREDSWTLLPPGFLDRAAGTGSGLVVPWAPQVAVLRHPSVGAFVTHAGWASVLEGVSSGVPMACRPFFGDQRMNARSVAHVWG 406          

HSP 2 Score: 29.6462 bits (65), Expect = 1.356e-54
Identity = 13/40 (32.50%), Postives = 24/40 (60.00%), Query Frame = 2
Query:  695 TKEGLLSSLDLILCQEKGIKIREKVTKLKQLCQNAIGPGG 814
            T  G+ ++++ +L  E+G ++R +   L+ L   A GPGG
Sbjct:  416 TSAGVAAAVEELLRGEEGARMRARAKVLQALVAEAFGPGG 455          
The following BLAST results are available for this feature:
BLAST of FC928898 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 42
Match NameE-valueIdentityDescription
UFOG_VITVI1.196e-7760.09Anthocyanidin 3-O-glucosyltransferase 2 OS=Vitis v... [more]
UFOG7_MANES2.316e-7764.68Anthocyanidin 3-O-glucosyltransferase 7 (Fragment)... [more]
UGFGT_ARATH2.897e-7662.39Flavonoid 3-O-glucosyltransferase OS=Arabidopsis t... [more]
KGLT_PETHY1.700e-7358.72Kaempferol 3-O-beta-D-galactosyltransferase OS=Pet... [more]
FORT_ARATH2.381e-6354.59Flavonol-3-O-glucoside L-rhamnosyltransferase OS=A... [more]
UFOG_SOLME1.054e-5753.49Anthocyanidin 3-O-glucosyltransferase OS=Solanum m... [more]
UGFGT_MEDTR1.791e-5749.08Flavonoid 3-O-glucosyltransferase OS=Medicago trun... [more]
UFOG_GENTR2.253e-5649.54Anthocyanidin 3-O-glucosyltransferase OS=Gentiana ... [more]
UFOG2_MAIZE6.121e-5549.78Anthocyanidin 3-O-glucosyltransferase OS=Zea mays ... [more]
UFOG3_MAIZE1.356e-5449.33Anthocyanidin 3-O-glucosyltransferase OS=Zea mays ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAH3BA08RM1 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH3BA08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC928898 ID=FC928898|Name=FC928898|organism=Citrus clementina|type=EST|length=817bp
GGAATGAATAAGATACGCGTCGCCGACTTGCCTGAAGGAGTTGTTTCCGG
AGACTTGGATTCAGTCTTTTCTGTTATGCTGCATCAAATGGGACGTCAGC
TACCCAAGGCAGCTGCTGTTTTCATCAACAGTTTTGAAGAGTTAGACCCT
GAGTTGACAAATCATCTCAAGACTAAATTCAACAACAAGTTTCTCAGTGT
TGGCCCTTTCAAGCTACTACTAGCATCTGATCAGCAACCGTCGTCCGCAA
CTGATTTGGATGATGAATATGGTTGCCTGGCGTGGCTGGACAAGCAGAAG
AAGAAACCTGCTTCAGTGGCGTATGTCAGCTTTGGTACAGTGGCAACACC
ATCTCCAAACGAAATTGTGGCAATAGCAGAGGCCTTGGAAGCAAGTAAAG
TGCCATTTATTTGGTCACTGAGACATAGGTCGCAGGCAAATCTGCCAAAT
GGGTTCCTGGAAAGGACAAGATCTGATGGAATTGTGGTGGATTGGGCCAC
CCAGGTCAATGTTTTAGCACATGAAGCAGTTGGGGTCTTTGTAACACATT
GTGGTTGGGGCTCAATCCTTGAAAGCATAGCTGCAGGTGTGCCGATGATC
GGGAGGCCATTCTTTGGGGATCAGCGGATTAATGGAAGAATGATGGAACA
AATATNGGGGGGTTGGTATCGCTGTAGATGGTGGAGGGATTTGCACAAAG
GAAGGTTTACTCAGCAGCTTGGATCTAATTTTGTGCCAAGAGAAAGGAAT
CAAAATAAGGGAGAAGGTTACAAAGCTGAAGCAACTGTGCCAAAATGCAA
TTGGTCCCGGTGGAAGT
back to top