FC928901

Overview
NameFC928901
Unique NameFC928901
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length854
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig789 contig Ccv1_Contig789:189..1042. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC928901 vs. ExPASy Swiss-Prot
Match: EF1A_ORYSJ (Elongation factor 1-alpha OS=Oryza sativa subsp. japonica GN=REFA1 PE=2 SV=2)

HSP 1 Score: 558.525 bits (1438), Expect = 1.670e-158
Identity = 272/276 (98.55%), Postives = 275/276 (99.64%), Query Frame = 1
Query:   25 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTE 852
            MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNP+K+PFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD INEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTE
Sbjct:    1 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTE 276          
BLAST of FC928901 vs. ExPASy Swiss-Prot
Match: EF1A_WHEAT (Elongation factor 1-alpha OS=Triticum aestivum GN=TEF1 PE=2 SV=1)

HSP 1 Score: 555.444 bits (1430), Expect = 1.413e-157
Identity = 270/276 (97.83%), Postives = 275/276 (99.64%), Query Frame = 1
Query:   25 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTE 852
            MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARY+EIVKEVSSYLKKVGYNP+KVPFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD INEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTE
Sbjct:    1 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYEEIVKEVSSYLKKVGYNPDKVPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTE 276          
BLAST of FC928901 vs. ExPASy Swiss-Prot
Match: EF1A_MANES (Elongation factor 1-alpha OS=Manihot esculenta GN=EF1 PE=3 SV=1)

HSP 1 Score: 552.747 bits (1423), Expect = 9.161e-157
Identity = 268/276 (97.10%), Postives = 273/276 (98.91%), Query Frame = 1
Query:   25 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTE 852
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNP+K+PFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD I EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG+LKPGMVVTFGP+GLTTE
Sbjct:    1 MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQIQEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGILKPGMVVTFGPTGLTTE 276          
BLAST of FC928901 vs. ExPASy Swiss-Prot
Match: EF1A_SOLLC (Elongation factor 1-alpha OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 552.362 bits (1422), Expect = 1.197e-156
Identity = 268/276 (97.10%), Postives = 274/276 (99.28%), Query Frame = 1
Query:   25 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTE 852
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNP+K+PFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD INEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTE
Sbjct:    1 MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTE 276          
BLAST of FC928901 vs. ExPASy Swiss-Prot
Match: EF1A_MAIZE (Elongation factor 1-alpha OS=Zea mays GN=EF1A PE=3 SV=1)

HSP 1 Score: 551.977 bits (1421), Expect = 1.563e-156
Identity = 269/276 (97.46%), Postives = 274/276 (99.28%), Query Frame = 1
Query:   25 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTE 852
            MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNP+K+ FVPISGFEGDNMIERSTNLDWYKGPTLL+ALD INEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGV+KPGMVVTFGP+GLTTE
Sbjct:    1 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPDKIHFVPISGFEGDNMIERSTNLDWYKGPTLLEALDLINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTE 276          
BLAST of FC928901 vs. ExPASy Swiss-Prot
Match: EF1A_TOBAC (Elongation factor 1-alpha OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 550.436 bits (1417), Expect = 4.547e-156
Identity = 268/276 (97.10%), Postives = 273/276 (98.91%), Query Frame = 1
Query:   25 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTE 852
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNP+K+PFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD IN+ KRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGP+GLTTE
Sbjct:    1 MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINDAKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPTGLTTE 276          
BLAST of FC928901 vs. ExPASy Swiss-Prot
Match: EF1A_ARATH (Elongation factor 1-alpha OS=Arabidopsis thaliana GN=A1 PE=1 SV=1)

HSP 1 Score: 550.051 bits (1416), Expect = 5.938e-156
Identity = 266/276 (96.38%), Postives = 273/276 (98.91%), Query Frame = 1
Query:   25 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTE 852
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEI+KEVSSYLKKVGYNP+K+PFVPISGFEGDNMIERSTNLDWYKGPTLL+ALD INEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG++KPGMVVTF P+GLTTE
Sbjct:    1 MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIIKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGMIKPGMVVTFAPTGLTTE 276          
BLAST of FC928901 vs. ExPASy Swiss-Prot
Match: EF1A1_DAUCA (Elongation factor 1-alpha OS=Daucus carota PE=3 SV=1)

HSP 1 Score: 550.051 bits (1416), Expect = 5.938e-156
Identity = 268/276 (97.10%), Postives = 270/276 (97.83%), Query Frame = 1
Query:   25 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTE 852
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFET KYYCTVIDAPGHRDFIKNMITGTSQADCAVLIID TTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEK+ FVPISGFEGDNMIERSTNLDWYKGPTLLDALD INEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETG +KPGMVVTFGPSGLTTE
Sbjct:    1 MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETNKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDPTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKIAFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGTIKPGMVVTFGPSGLTTE 276          
BLAST of FC928901 vs. ExPASy Swiss-Prot
Match: EF1A_SOYBN (Elongation factor 1-alpha OS=Glycine max GN=TEFS1 PE=3 SV=2)

HSP 1 Score: 549.666 bits (1415), Expect = 7.756e-156
Identity = 267/276 (96.74%), Postives = 273/276 (98.91%), Query Frame = 1
Query:   25 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTE 852
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALL+FTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNP+K+PFVPISGFEGDNMIERSTNLDWYKGPTLLDALD I+EPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTF P+GLTTE
Sbjct:    1 MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLSFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDQISEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPTGLTTE 276          
BLAST of FC928901 vs. ExPASy Swiss-Prot
Match: EF1A_VICFA (Elongation factor 1-alpha OS=Vicia faba PE=2 SV=1)

HSP 1 Score: 547.74 bits (1410), Expect = 2.947e-155
Identity = 265/276 (96.01%), Postives = 272/276 (98.55%), Query Frame = 1
Query:   25 MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPEKVPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFGPSGLTTE 852
            MGKEK HINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFET+KYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSK RY+EIVKEVSSYLKKVGYNP+K+PFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIG VPVGRVETGV+KPGM+VTF P+GLTTE
Sbjct:    1 MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETSKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKGRYEEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLDALDNINEPKRPSDKPLRLPLQDVYKIGGIGIVPVGRVETGVVKPGMLVTFAPTGLTTE 276          
The following BLAST results are available for this feature:
BLAST of FC928901 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
EF1A_ORYSJ1.670e-15898.55Elongation factor 1-alpha OS=Oryza sativa subsp. j... [more]
EF1A_WHEAT1.413e-15797.83Elongation factor 1-alpha OS=Triticum aestivum GN=... [more]
EF1A_MANES9.161e-15797.10Elongation factor 1-alpha OS=Manihot esculenta GN=... [more]
EF1A_SOLLC1.197e-15697.10Elongation factor 1-alpha OS=Solanum lycopersicum ... [more]
EF1A_MAIZE1.563e-15697.46Elongation factor 1-alpha OS=Zea mays GN=EF1A PE=3... [more]
EF1A_TOBAC4.547e-15697.10Elongation factor 1-alpha OS=Nicotiana tabacum PE=... [more]
EF1A_ARATH5.938e-15696.38Elongation factor 1-alpha OS=Arabidopsis thaliana ... [more]
EF1A1_DAUCA5.938e-15697.10Elongation factor 1-alpha OS=Daucus carota PE=3 SV... [more]
EF1A_SOYBN7.756e-15696.74Elongation factor 1-alpha OS=Glycine max GN=TEFS1 ... [more]
EF1A_VICFA2.947e-15596.01Elongation factor 1-alpha OS=Vicia faba PE=2 SV=1[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAH3BA11RM1 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH3BA11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC928901 ID=FC928901|Name=FC928901|organism=Citrus clementina|type=EST|length=854bp
AAGGTTTTATACTAGATTTGCATAATGGGTAAGGAGAAGACTCACATCAA
CATTGTGGTCATCGGCCATGTCGACTCTGGAAAGTCGACCACCACCGGAC
ACTTGATCTACAAGCTTGGTGGTATTGACAAGCGTGTGATCGAGAGGTTC
GAGAAGGAAGCTGCTGAGATGAACAAGAGGTCATTCAAATACGCCTGGGT
GCTCGACAAGCTCAAGGCTGAGCGTGAACGTGGTATTACCATTGATATTG
CCTTGTGGAAGTTCGAGACCACCAAGTACTACTGCACCGTCATTGATGCT
CCCGGACATCGTGACTTTATCAAGAACATGATTACCGGTACCTCACAGGC
TGACTGTGCCGTCCTTATCATTGACTCCACCACCGGTGGTTTTGAAGCTG
GTATCTCCAAGGATGGTCAGACTCGTGAGCATGCTTTGCTTGCTTTCACC
CTTGGTGTGAAGCAGATGATTTGCTGCTGTAACAAGATGGACGCCACCAC
CCCCAAGTACTCAAAGGCTAGGTACGATGAAATTGTGAAGGAGGTCTCTT
CCTACCTGAAGAAGGTTGGATACAACCCCGAGAAAGTCCCATTCGTGCCC
ATCTCTGGTTTCGAGGGTGACAACATGATTGAGAGGTCTACCAACCTTGA
CTGGTACAAGGGTCCAACCCTGCTGGACGCTCTTGACAATATCAATGAGC
CGAAGAGGCCCTCAGACAAGCCCCTTCGTCTGCCACTCCAGGACGTGTAC
AAGATTGGTGGCATTGGAACCGTCCCAGTGGGTCGCGTTGAGACCGGTGT
CCTCAAGCCTGGTATGGTGGTGACATTTGGCCCCTCTGGATTGACAACTG
AGGT
back to top