FC928993

Overview
NameFC928993
Unique NameFC928993
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length390
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9282 contig Ccv1_Contig9282:1..390. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC928993 vs. ExPASy Swiss-Prot
Match: ILL4_ARATH (IAA-amino acid hydrolase ILR1-like 4 OS=Arabidopsis thaliana GN=ILL4 PE=1 SV=2)

HSP 1 Score: 207.608 bits (527), Expect = 1.587e-53
Identity = 104/129 (80.62%), Postives = 117/129 (90.70%), Query Frame = 1
Query:    4 TMLLGAAKILQEHREELKGTVVLVFQPAEEGGGGAHKVLEAGVLEKVNAIFGLHVDPNLPIGEVASRPGPLLAGSGFFEAVIXGKGGHAAIPQHSIDPILAASNVIVSLQHLVSREADPLDSQVVEVPK 390
            TMLLGAAK+L+EH EEL+GTVVLVFQPAEEGGGGA K++EAGVLE V+AIFGLHV   L +G+V+SR GP+LAGSGFF+A I GKGGHAA+PQH+IDPILAASNVIVSLQHLVSREADPLDSQVV V K
Sbjct:  141 TMLLGAAKLLKEHEEELQGTVVLVFQPAEEGGGGAKKIVEAGVLENVSAIFGLHVTNQLALGQVSSREGPMLAGSGFFKAKISGKGGHAALPQHTIDPILAASNVIVSLQHLVSREADPLDSQVVTVAK 269          
BLAST of FC928993 vs. ExPASy Swiss-Prot
Match: ILL1_ORYSJ (IAA-amino acid hydrolase ILR1-like 1 OS=Oryza sativa subsp. japonica GN=ILL1 PE=2 SV=1)

HSP 1 Score: 202.601 bits (514), Expect = 5.106e-52
Identity = 101/130 (77.69%), Postives = 115/130 (88.46%), Query Frame = 1
Query:    1 VTMLLGAAKILQEHREELKGTVVLVFQPAEEGGGGAHKVLEAGVLEKVNAIFGLHVDPNLPIGEVASRPGPLLAGSGFFEAVIXGKGGHAAIPQHSIDPILAASNVIVSLQHLVSREADPLDSQVVEVPK 390
            V MLLG+A+ILQEHR+ELKGTVVLVFQPAEEGGGGA K+++ G +E + AIFG+HV   +PIG VASRPGP++AGSGFFEAVI GKGGHAA+P H+IDPILAASNVIVSLQ LVSREADPLDSQVV V K
Sbjct:  141 VAMLLGSARILQEHRDELKGTVVLVFQPAEEGGGGAKKMIDDGAVENIEAIFGVHVADVVPIGVVASRPGPVMAGSGFFEAVISGKGGHAALPHHTIDPILAASNVIVSLQQLVSREADPLDSQVVTVGK 270          
BLAST of FC928993 vs. ExPASy Swiss-Prot
Match: ILL1_ORYSI (IAA-amino acid hydrolase ILR1-like 1 OS=Oryza sativa subsp. indica GN=ILL1 PE=2 SV=1)

HSP 1 Score: 202.601 bits (514), Expect = 5.106e-52
Identity = 101/130 (77.69%), Postives = 115/130 (88.46%), Query Frame = 1
Query:    1 VTMLLGAAKILQEHREELKGTVVLVFQPAEEGGGGAHKVLEAGVLEKVNAIFGLHVDPNLPIGEVASRPGPLLAGSGFFEAVIXGKGGHAAIPQHSIDPILAASNVIVSLQHLVSREADPLDSQVVEVPK 390
            V MLLG+A+ILQEHR+ELKGTVVLVFQPAEEGGGGA K+++ G +E + AIFG+HV   +PIG VASRPGP++AGSGFFEAVI GKGGHAA+P H+IDPILAASNVIVSLQ LVSREADPLDSQVV V K
Sbjct:  141 VAMLLGSARILQEHRDELKGTVVLVFQPAEEGGGGAKKMIDDGTVENIEAIFGVHVADVVPIGVVASRPGPVMAGSGFFEAVISGKGGHAALPHHTIDPILAASNVIVSLQQLVSREADPLDSQVVTVGK 270          
BLAST of FC928993 vs. ExPASy Swiss-Prot
Match: ILL5_ARATH (IAA-amino acid hydrolase ILR1-like 5 OS=Arabidopsis thaliana GN=ILL5 PE=3 SV=1)

HSP 1 Score: 189.504 bits (480), Expect = 4.473e-48
Identity = 95/127 (74.80%), Postives = 112/127 (88.19%), Query Frame = 1
Query:    4 TMLLGAAKILQEHREELKGTVVLVFQPAEEGGGGAHKVLEAGVLEKVNAIFGLHVDPNLPIGEVASRPGPLLAGSGFFEAVIXGKGGHAAIPQHSIDPILAASNVIVSLQHLVSREADPLDSQVVEV 384
            TMLLGAAK+L+EH+EEL+GTV+LVFQPAEEGG GA K++EAGVLE V AIFGLHV   L +G+++SR G L+AGSG F+A I GKGGHAA+PQ +IDP+LAASNVI+SLQHLVSREADPLDSQVV V
Sbjct:  141 TMLLGAAKLLKEHQEELQGTVILVFQPAEEGGAGAKKIVEAGVLENVGAIFGLHVSNLLGLGQLSSREGLLMAGSGRFKATISGKGGHAALPQFAIDPVLAASNVILSLQHLVSREADPLDSQVVTV 267          
BLAST of FC928993 vs. ExPASy Swiss-Prot
Match: ILL2_ARATH (IAA-amino acid hydrolase ILR1-like 2 OS=Arabidopsis thaliana GN=ILL2 PE=1 SV=2)

HSP 1 Score: 178.718 bits (452), Expect = 7.895e-45
Identity = 88/130 (67.69%), Postives = 105/130 (80.77%), Query Frame = 1
Query:    1 VTMLLGAAKILQEHREELKGTVVLVFQPAEEGGGGAHKVLEAGVLEKVNAIFGLHVDPNLPIGEVASRPGPLLAGSGFFEAVIXGKGGHAAIPQHSIDPILAASNVIVSLQHLVSREADPLDSQVVEVPK 390
            VTMLLGAAKIL EHR  L+GTVVL+FQPAEEG  GA K+ E G L+ V AIFG+H+   +P G+ ASR G  LAG+G FEAVI GKGGHAAIPQH+IDP++AAS++++SLQ LVSRE DPLDS+VV V K
Sbjct:  143 VTMLLGAAKILHEHRHHLQGTVVLIFQPAEEGLSGAKKMREEGALKNVEAIFGIHLSARIPFGKAASRAGSFLAGAGVFEAVITGKGGHAAIPQHTIDPVVAASSIVLSLQQLVSRETDPLDSKVVTVSK 272          
BLAST of FC928993 vs. ExPASy Swiss-Prot
Match: ILL2_ORYSJ (IAA-amino acid hydrolase ILR1-like 2 OS=Oryza sativa subsp. japonica GN=ILL2 PE=2 SV=1)

HSP 1 Score: 175.637 bits (444), Expect = 6.684e-44
Identity = 89/129 (68.99%), Postives = 104/129 (80.62%), Query Frame = 1
Query:    4 TMLLGAAKILQEHREELKGTVVLVFQPAEEGGGGAHKVLEAGVLEKVNAIFGLHVDPNLPIGEVASRPGPLLAGSGFFEAVIXGKGGHAAIPQHSIDPILAASNVIVSLQHLVSREADPLDSQVVEVPK 390
            TMLLGAA+ILQE R EL+GTVVL+FQP EE G GA +++EAG ++ V AIFG HV   LP G V SRPGPLLAG GFFEAVI GKGGHAA P  S+DPILAAS V+++LQ LVSREADPL++QVV V +
Sbjct:  156 TMLLGAARILQERRHELQGTVVLLFQPGEEVGTGARRMVEAGAVDNVEAIFGFHVSVELPTGVVGSRPGPLLAGCGFFEAVITGKGGHAAHPHASVDPILAASTVVLALQGLVSREADPLEAQVVTVTR 284          
BLAST of FC928993 vs. ExPASy Swiss-Prot
Match: ILL1_ARATH (IAA-amino acid hydrolase ILR1-like 1 OS=Arabidopsis thaliana GN=ILL1 PE=1 SV=1)

HSP 1 Score: 174.866 bits (442), Expect = 1.140e-43
Identity = 85/130 (65.38%), Postives = 104/130 (80.00%), Query Frame = 1
Query:    1 VTMLLGAAKILQEHREELKGTVVLVFQPAEEGGGGAHKVLEAGVLEKVNAIFGLHVDPNLPIGEVASRPGPLLAGSGFFEAVIXGKGGHAAIPQHSIDPILAASNVIVSLQHLVSREADPLDSQVVEVPK 390
            V MLLGAAKILQ+HR+ L+GTVVL+FQPAEEG  GA  + E G L+ V AIFG+H+ P  P G+ AS  G  +AG+G FEAVI GKGGHAAIPQH+IDP++AAS++++SLQHLVSRE DP DS+VV V K
Sbjct:  142 VAMLLGAAKILQQHRQHLQGTVVLIFQPAEEGLSGAKMMREEGALKNVEAIFGIHLSPRTPFGKAASLAGSFMAGAGAFEAVITGKGGHAAIPQHTIDPVVAASSIVLSLQHLVSRETDPSDSKVVTVTK 271          
BLAST of FC928993 vs. ExPASy Swiss-Prot
Match: ILL8_ORYSJ (IAA-amino acid hydrolase ILR1-like 8 OS=Oryza sativa subsp. japonica GN=ILL8 PE=2 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 9.033e-41
Identity = 77/128 (60.16%), Postives = 101/128 (78.91%), Query Frame = 1
Query:    1 VTMLLGAAKILQEHREELKGTVVLVFQPAEEGGGGAHKVLEAGVLEKVNAIFGLHVDPNLPIGEVASRPGPLLAGSGFFEAVIXGKGGHAAIPQHSIDPILAASNVIVSLQHLVSREADPLDSQVVEV 384
            VTMLLGAAK+LQ  ++ELKGT+ LVFQPAEEG  GA+ VLE+G+L+ V+ IFGLHV PNLP+G VASRPGP ++ +  F A   GKGGHA +P  ++DP++A S+ ++SLQ LVSRE DPL++ VV +
Sbjct:  151 VTMLLGAAKLLQSRKDELKGTIKLVFQPAEEGHAGAYHVLESGLLDDVSVIFGLHVIPNLPVGVVASRPGPFMSAAARFAATFTGKGGHAGVPHDAVDPVVAVSSAVLSLQQLVSRETDPLEAAVVSI 278          
BLAST of FC928993 vs. ExPASy Swiss-Prot
Match: ILL7_ORYSJ (IAA-amino acid hydrolase ILR1-like 7 OS=Oryza sativa subsp. japonica GN=ILL7 PE=2 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 9.033e-41
Identity = 82/127 (64.57%), Postives = 100/127 (78.74%), Query Frame = 1
Query:    4 TMLLGAAKILQEHREELKGTVVLVFQPAEEGGGGAHKVLEAGVLEKVNAIFGLHVDPNLPIGEVASRPGPLLAGSGFFEAVIXGKGGHAAIPQHSIDPILAASNVIVSLQHLVSREADPLDSQVVEV 384
            TMLLGAAK+LQ  +++LKGTV LVFQPAEEG  GA  VL+ GVL+ V+AIFGLHVDP + +G V SRPGP LA SG F A I GKGGHAA P +++DPIL AS+ IVSLQ +V+RE DPL++ V+ V
Sbjct:  163 TMLLGAAKLLQSQKDDLKGTVKLVFQPAEEGYAGARYVLQEGVLDDVSAIFGLHVDPRIQVGTVTSRPGPFLAASGRFLATITGKGGHAAGPHNAVDPILTASSAIVSLQQIVARETDPLEAAVISV 289          
BLAST of FC928993 vs. ExPASy Swiss-Prot
Match: ILL9_ORYSJ (IAA-amino acid hydrolase ILR1-like 9 OS=Oryza sativa subsp. japonica GN=ILL9 PE=2 SV=2)

HSP 1 Score: 164.851 bits (416), Expect = 1.180e-40
Identity = 81/126 (64.29%), Postives = 99/126 (78.57%), Query Frame = 1
Query:    7 MLLGAAKILQEHREELKGTVVLVFQPAEEGGGGAHKVLEAGVLEKVNAIFGLHVDPNLPIGEVASRPGPLLAGSGFFEAVIXGKGGHAAIPQHSIDPILAASNVIVSLQHLVSREADPLDSQVVEV 384
            MLLGAAK+LQ+ + ELKGTV LVFQPAEEG  GA+ VL+ GVL+ V+A+FG+HVDP LP+G VA+RPGP  A SG F A I GKGGHAA P  +IDP++AASN I+SLQ +V+RE DPL   VV +
Sbjct:  149 MLLGAAKLLQKRKNELKGTVKLVFQPAEEGSAGAYYVLQEGVLDDVSAMFGMHVDPALPVGVVAARPGPFAATSGRFLATITGKGGHAAFPHDAIDPVVAASNAILSLQQIVAREIDPLQGAVVSI 274          
The following BLAST results are available for this feature:
BLAST of FC928993 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 101
Match NameE-valueIdentityDescription
ILL4_ARATH1.587e-5380.62IAA-amino acid hydrolase ILR1-like 4 OS=Arabidopsi... [more]
ILL1_ORYSJ5.106e-5277.69IAA-amino acid hydrolase ILR1-like 1 OS=Oryza sati... [more]
ILL1_ORYSI5.106e-5277.69IAA-amino acid hydrolase ILR1-like 1 OS=Oryza sati... [more]
ILL5_ARATH4.473e-4874.80IAA-amino acid hydrolase ILR1-like 5 OS=Arabidopsi... [more]
ILL2_ARATH7.895e-4567.69IAA-amino acid hydrolase ILR1-like 2 OS=Arabidopsi... [more]
ILL2_ORYSJ6.684e-4468.99IAA-amino acid hydrolase ILR1-like 2 OS=Oryza sati... [more]
ILL1_ARATH1.140e-4365.38IAA-amino acid hydrolase ILR1-like 1 OS=Arabidopsi... [more]
ILL8_ORYSJ9.033e-4160.16IAA-amino acid hydrolase ILR1-like 8 OS=Oryza sati... [more]
ILL7_ORYSJ9.033e-4164.57IAA-amino acid hydrolase ILR1-like 7 OS=Oryza sati... [more]
ILL9_ORYSJ1.180e-4064.29IAA-amino acid hydrolase ILR1-like 9 OS=Oryza sati... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAH3BF09RM1 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH3BF09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC928993 ID=FC928993|Name=FC928993|organism=Citrus clementina|type=EST|length=390bp
GTCACCATGCTTCTAGGTGCAGCAAAAATTCTTCAAGAGCACCGTGAGGA
GTTAAAGGGTACAGTTGTTCTGGTTTTCCAACCAGCCGAAGAAGGAGGTG
GAGGAGCCCACAAAGTGCTCGAAGCAGGAGTCCTGGAAAAAGTTAATGCC
ATATTTGGGTTACATGTCGACCCTAACTTACCCATAGGTGAAGTAGCTTC
AAGACCTGGTCCTCTGTTAGCTGGGAGTGGCTTCTTTGAAGCAGTAATAN
GTGGAAAAGGAGGTCATGCGGCCATTCCTCAGCATTCAATAGATCCAATA
TTGGCAGCTTCTAATGTGATTGTTAGTTTACAACATCTTGTTTCTCGTGA
AGCTGATCCACTTGATTCACAGGTCGTGGAAGTTCCAAAA
back to top