FC928995

Overview
NameFC928995
Unique NameFC928995
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length802
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9262 contig Ccv1_Contig9262:11..812. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC928995 vs. ExPASy Swiss-Prot
Match: Y4141_ARATH (Uncharacterized protein At4g14100 OS=Arabidopsis thaliana GN=At4g14100 PE=2 SV=1)

HSP 1 Score: 284.648 bits (727), Expect = 4.228e-76
Identity = 126/189 (66.67%), Postives = 151/189 (79.89%), Query Frame = 2
Query:   17 KPIVICFIFFLSTLSSYVCARSSSAIPKPKAWPLQFHSILWMNYNGSLEMIDLWYDWSNGRNFNIIQSQLGKLLYDLEWNNGTSFFFTLDSNKECRTAQLEVGILRPNWLDGAKYLGQRHVDGFLCNVWEKADFIVYYEDVLTKRPVHWVFYTGRQAHVITFEVGAVLEDAKWQAPVYCFDKTNELEAT 583
            +P+++  IF   T    + A      P P  WP QFH++++MNY+G L MIDLWYDW+NGRNFNIIQ QLG + YDLEWNNGTSFF+TLD +K CR+ QLEVGILRPNWLDGAKYLGQ++V GFLCNVWEK DFI YYEDV TKRPV W+FYTGR+AH++T+EVGAVLED KWQAPVYCF+K  +  +T
Sbjct:    5 RPLIVIVIFIYITAGVKIAAADE---PVPTPWPHQFHALMFMNYSGDLSMIDLWYDWTNGRNFNIIQEQLGGITYDLEWNNGTSFFYTLDESKSCRSGQLEVGILRPNWLDGAKYLGQQNVSGFLCNVWEKVDFIWYYEDVETKRPVQWIFYTGREAHIMTYEVGAVLEDEKWQAPVYCFNKEKKSLST 190          
The following BLAST results are available for this feature:
BLAST of FC928995 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
Y4141_ARATH4.228e-7666.67Uncharacterized protein At4g14100 OS=Arabidopsis t... [more]
back to top
Properties
Property NameValue
Genbank descriptionKN0AAH3BF11RM1 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH3BF11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC928995 ID=FC928995|Name=FC928995|organism=Citrus clementina|type=EST|length=802bp
GGCACGAGGCTCGACCAAACCCATTGTCATCTGCTTCATCTTCTTCTTAT
CCACTTTATCTTCCTATGTTTGTGCACGATCATCATCAGCAATTCCAAAG
CCAAAGGCATGGCCTCTCCAATTCCACTCAATACTGTGGATGAATTACAA
CGGGTCTCTCGAAATGATCGATCTCTGGTACGACTGGTCCAACGGCAGAA
ACTTCAACATCATTCAAAGCCAGCTGGGCAAGCTGCTCTACGACCTCGAA
TGGAACAACGGCACTTCCTTCTTCTTCACGTTGGATTCTAACAAAGAGTG
TAGAACTGCACAGCTTGAGGTTGGAATTCTGCGCCCTAATTGGCTGGATG
GTGCTAAGTATCTGGGTCAAAGACACGTGGATGGCTTCCTTTGCAATGTC
TGGGAAAAGGCTGACTTTATAGTCTATTATGAGGATGTCCTCACCAAAAG
GCCTGTGCATTGGGTTTTTTACACTGGGCGGCAGGCTCATGTGATAACAT
TTGAAGTTGGAGCAGTGCTTGAAGATGCAAAGTGGCAAGCCCCTGTTTAC
TGCTTCGATAAAACCAATGAACTAGAAGCCACCGTCACTGCTTCTCAGGG
ACGAGTGCTCGATGGGTTTTTTGAAGGTCCCAGGCAGCTCTGATTCTGAA
TCAATGTGAGTGGTGTTTCTAATATCATATGGCCAGCTTCCGTTAAATGT
TAGAGCAAGACTGCTTCTTTATCACTTGCCTTCTGCTTTTTGTCATTCTT
GCCATTAGATTATTTATCTGGAGTTACAGAAGCAATGTAAACAGGTATCT
TC
back to top