FC928997

Overview
NameFC928997
Unique NameFC928997
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length740
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC928997_ssr496 microsatellite FC928997_ssr496:496..505. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig6637 contig Ccv1_Contig6637:54..793. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC928997 vs. ExPASy Swiss-Prot
Match: HSP21_SOYBN (17.9 kDa class II heat shock protein OS=Glycine max GN=HSP17.9-D PE=3 SV=1)

HSP 1 Score: 240.736 bits (613), Expect = 6.106e-63
Identity = 121/160 (75.62%), Postives = 136/160 (85.00%), Query Frame = 2
Query:    8 MDFRIMGLDSSPLFSTLQHMMEMGADDSADNKSSNAPTRTYVRDAKAMAATPADVKEYPNSYVFIVDMPGLKSGDIKVQVEDDNVLLISGERKREEEKDGAKYVRMERRVGKFMRKFVLPENANVEAISAVCQDGVLTVTVDXXXXXXXXXXXTIEVKIA 487
            MDFR+MGL+S PLF TLQHMM+M  D + DNK+ NAPT +YVRDAKAMAATPADVKEYPNSYVF +DMPGLKSGDIKVQVEDDN+LLI GERKR+EEK+GAKY+RMERRVGK MRKFVLPENAN +AISAVCQDGVL+VTV            TI+VK+A
Sbjct:    1 MDFRVMGLES-PLFHTLQHMMDMSEDGAGDNKTHNAPTWSYVRDAKAMAATPADVKEYPNSYVFEIDMPGLKSGDIKVQVEDDNLLLICGERKRDEEKEGAKYLRMERRVGKLMRKFVLPENANTDAISAVCQDGVLSVTVQKLPPPEPKKPRTIQVKVA 159          
BLAST of FC928997 vs. ExPASy Swiss-Prot
Match: HSP21_SOLPE (17.3 kDa class II heat shock protein OS=Solanum peruvianum PE=2 SV=1)

HSP 1 Score: 235.343 bits (599), Expect = 2.565e-61
Identity = 118/160 (73.75%), Postives = 133/160 (83.12%), Query Frame = 2
Query:    8 MDFRIMGLDSSPLFSTLQHMMEMGADDSADNKSSNAPTRTYVRDAKAMAATPADVKEYPNSYVFIVDMPGLKSGDIKVQVEDDNVLLISGERKREEEKDGAKYVRMERRVGKFMRKFVLPENANVEAISAVCQDGVLTVTVDXXXXXXXXXXXTIEVKIA 487
            MD R++G+D++PLF TL HMME   +DS      NAP++ YVRDAKAMAATPADVKEYPNSYVF+VDMPGLKSGDIKVQVE+DNVLLISGERKREEEK+GAK++RMERRVGKFMRKF LPENAN +AISAVCQDGVLTVTV            TIEVK+A
Sbjct:    1 MDLRLLGIDNTPLFHTLHHMMEAAGEDSV-----NAPSKIYVRDAKAMAATPADVKEYPNSYVFVVDMPGLKSGDIKVQVEEDNVLLISGERKREEEKEGAKFIRMERRVGKFMRKFSLPENANTDAISAVCQDGVLTVTVQKLPPPEPKKPKTIEVKVA 155          
BLAST of FC928997 vs. ExPASy Swiss-Prot
Match: HSP21_PEA (17.1 kDa class II heat shock protein OS=Pisum sativum GN=HSP17.7 PE=2 SV=1)

HSP 1 Score: 218.779 bits (556), Expect = 2.485e-56
Identity = 112/155 (72.26%), Postives = 130/155 (83.87%), Query Frame = 2
Query:   23 MGLDSSPLFSTLQHMMEMGADDSADNKSSNAPTRTYVRDAKAMAATPADVKEYPNSYVFIVDMPGLKSGDIKVQVEDDNVLLISGERKREEEKDGAKYVRMERRVGKFMRKFVLPENANVEAISAVCQDGVLTVTVDXXXXXXXXXXXTIEVKIA 487
            M LDS PLF+TL H+M++   D    K+ NAPTRTYVRDAKAMAATPADVKE+PNSYVF+VDMPG+KSGDIKVQVED+NVLLISGERKREEEK+G KY++MERR+GK MRKFVLPENAN+EAISA+ QDGVLTVTV+           TI+VK+A
Sbjct:    1 MDLDS-PLFNTLHHIMDL--TDDTTEKNLNAPTRTYVRDAKAMAATPADVKEHPNSYVFMVDMPGVKSGDIKVQVEDENVLLISGERKREEEKEGVKYLKMERRIGKLMRKFVLPENANIEAISAISQDGVLTVTVNKLPPPEPKKPKTIQVKVA 152          
BLAST of FC928997 vs. ExPASy Swiss-Prot
Match: HSP21_IPONI (17.2 kDa class II heat shock protein OS=Ipomoea nil GN=SHSP-1 PE=2 SV=1)

HSP 1 Score: 209.92 bits (533), Expect = 1.154e-53
Identity = 114/160 (71.25%), Postives = 127/160 (79.38%), Query Frame = 2
Query:    8 MDFRIMGLDSSPLFSTLQHMMEMGADDSADNKSSNAPTRTYVRDAKAMAATPADVKEYPNSYVFIVDMPGLKSGDIKVQVEDDNVLLISGERKRE-EEKDGAKYVRMERRVGKFMRKFVLPENANVEAISAVCQDGVLTVTVDXXXXXXXXXXXTIEVKI 484
            MD R+MG D  PLF    H+M+   DD + N  S+AP+RT++ DAKAMAATPADVKEYPNSYVFI+DMPGLKSGDIKVQV+ DNVL ISGERKRE EEK+GAKYVRMERRVGK MRKFVLPENAN E I+AVCQDGVLTVTV+           TIEVKI
Sbjct:    1 MDLRLMGFDH-PLF---HHIMDYAGDDKSSN--SSAPSRTFMLDAKAMAATPADVKEYPNSYVFIIDMPGLKSGDIKVQVDGDNVLSISGERKREAEEKEGAKYVRMERRVGKLMRKFVLPENANKEKITAVCQDGVLTVTVENVPPPEPKKPRTIEVKI 154          
BLAST of FC928997 vs. ExPASy Swiss-Prot
Match: HSP21_HELAN (17.9 kDa class II heat shock protein OS=Helianthus annuus GN=HSP17.9 PE=2 SV=1)

HSP 1 Score: 201.445 bits (511), Expect = 4.105e-51
Identity = 103/157 (65.61%), Postives = 125/157 (79.62%), Query Frame = 2
Query:   20 IMGLDSSPLFSTLQHMMEMGADDSADNKSSNA-PTRTYVRDAKAMAATPADVKEYPNSYVFIVDMPGLKSGDIKVQVEDDNVLLISGERKREEEKDGAKYVRMERRVGKFMRKFVLPENANVEAISAVCQDGVLTVTVDXXXXXXXXXXXTIEVKIA 487
            +MG D  PL   L +++E   D++  NKS+N+ P+R YVRDA+AMAATPADVKE PNSYVFIVDMPGLKSGDIKVQVE DNVL+ISG+R REEEK+G KYVRMERR+GKFM+KF LPE+AN + ISA+CQDGVLTVTV+           TI+V++A
Sbjct:    6 LMGFD--PLLRNLHYILEATDDNTTGNKSNNSGPSRAYVRDARAMAATPADVKECPNSYVFIVDMPGLKSGDIKVQVERDNVLVISGKRNREEEKEGVKYVRMERRMGKFMKKFALPEDANTDKISAICQDGVLTVTVEKLPPPEPKKPKTIQVQVA 160          
BLAST of FC928997 vs. ExPASy Swiss-Prot
Match: HSP22_IPONI (18.8 kDa class II heat shock protein OS=Ipomoea nil GN=SHSP-2 PE=2 SV=1)

HSP 1 Score: 194.126 bits (492), Expect = 6.554e-49
Identity = 105/167 (62.87%), Postives = 122/167 (73.05%), Query Frame = 2
Query:    8 MDFRIMGLDS----SPLFSTLQHMMEMGAD-DSADNKSSNAPTRTYVRDAKAMAATPADVKEYPNSYVFIVDMPGLKSGDIKVQVEDDNVLLISGER--KREEEKDGAKYVRMERRVGKFMRKFVLPENANVEAISAVCQDGVLTVTVDXXXXXXXXXXXTIEVKIA 487
            MD R  GL +      L ST+Q M++   D D A       P R YVRDAKAMAATPADVKEYPNSYVFI DMPG+K+ +IKVQVEDDNVL++SGER  + ++EKDG KY+RMERRVGKFMRKFVLPENANVEAI+AV QDGVL VTV+           T+EVK+A
Sbjct:    1 MDLRNFGLSNFGLEPQLLSTIQDMLDFADDHDRAGRAPPEQPIRAYVRDAKAMAATPADVKEYPNSYVFIADMPGVKAAEIKVQVEDDNVLVVSGERTEREKDEKDGVKYLRMERRVGKFMRKFVLPENANVEAINAVYQDGVLQVTVEKLPPPEPKKPKTVEVKVA 167          
BLAST of FC928997 vs. ExPASy Swiss-Prot
Match: HSP22_MAIZE (17.8 kDa class II heat shock protein OS=Zea mays PE=2 SV=1)

HSP 1 Score: 191.045 bits (484), Expect = 5.548e-48
Identity = 98/165 (59.39%), Postives = 128/165 (77.58%), Query Frame = 2
Query:    8 MDFRIMGLDSSPLFSTLQHMMEMGADDSA---DNK--SSNAPTRTYVRDAKAMAATPADVKEYPNSYVFIVDMPGLKSGDIKVQVEDDNVLLISGERKREEEKDGAKYVRMERRVGKFMRKFVLPENANVEAISAVCQDGVLTVTVDXXXXXXXXXXXTIEVKIA 487
            MD  + GL++ PL + LQH++++   D+    DNK  S  + TRTYVRDA+AMAATPADVKE P +Y F+VDMPGL +GDI+VQVED+ VL++SGER+REE +D AKY+RMERR+GKFMRKFVLP+NA+V+ ++AVC+DGVLTVTV+           TIEVK+A
Sbjct:    1 MDAVMFGLET-PLMAALQHLLDVPDGDAGAGGDNKTGSGGSATRTYVRDARAMAATPADVKELPGAYAFVVDMPGLGTGDIRVQVEDERVLVVSGERRREEREDDAKYLRMERRMGKFMRKFVLPDNADVDKVAAVCRDGVLTVTVEKLPPPEPKKPKTIEVKVA 164          
BLAST of FC928997 vs. ExPASy Swiss-Prot
Match: HSP21_MAIZE (17.5 kDa class II heat shock protein OS=Zea mays PE=2 SV=1)

HSP 1 Score: 187.963 bits (476), Expect = 4.697e-47
Identity = 98/163 (60.12%), Postives = 123/163 (75.46%), Query Frame = 2
Query:    8 MDFRIMGLDSSPLFSTLQHMMEMGADDSA---DNKSSNAPTRTYVRDAKAMAATPADVKEYPNSYVFIVDMPGLKSGDIKVQVEDDNVLLISGERKREEEKDGAKYVRMERRVGKFMRKFVLPENANVEAISAVCQDGVLTVTVDXXXXXXXXXXXTIEVKIA 487
            MD R+ GL++ PL   LQH++++   D+    D      PTRTYV DA+AMA TPADVKE P +Y F+VDMPGL +GDIKVQVED+ VL+ISGER+REE +D AKY+RMERR+GKFMRKFVLP+NA+++ ISAVC+DGVLTVTV+           TIEVK+A
Sbjct:    1 MDGRMFGLET-PLMVALQHLLDVPDGDAGAGGDKAGGGGPTRTYVADARAMAVTPADVKELPGAYAFVVDMPGLGTGDIKVQVEDERVLVISGERRREERED-AKYLRMERRMGKFMRKFVLPDNADMDKISAVCRDGVLTVTVEKLPPPEPKKPKTIEVKVA 161          
BLAST of FC928997 vs. ExPASy Swiss-Prot
Match: HSP23_MAIZE (17.0 kDa class II heat shock protein OS=Zea mays GN=HSP18 PE=2 SV=1)

HSP 1 Score: 181.03 bits (458), Expect = 5.742e-45
Identity = 93/160 (58.13%), Postives = 122/160 (76.25%), Query Frame = 2
Query:    8 MDFRIMGLDSSPLFSTLQHMMEMGADDSADNKSSNAPTRTYVRDAKAMAATPADVKEYPNSYVFIVDMPGLKSGDIKVQVEDDNVLLISGERKREEEKDGAKYVRMERRVGKFMRKFVLPENANVEAISAVCQDGVLTVTVDXXXXXXXXXXXTIEVKIA 487
            MD R+ GL++ P  + L H++++   D    K+    TRTYVRDA+AMAATPADVKE   +Y F+VDMPGL +GDI+VQVED+ VL+ISGER+REE +D AKY+RMERR+GKFMRKFVLP+NA+V+ ++AVC+DGVLTVTV+           TIE+K+A
Sbjct:    1 MDARMFGLET-PRVAALHHLLDVPDGD----KAGGGATRTYVRDARAMAATPADVKELAGAYAFVVDMPGLSTGDIRVQVEDERVLVISGERRREERED-AKYLRMERRMGKFMRKFVLPDNADVDKVAAVCRDGVLTVTVEKLPPPEPKKPKTIEIKVA 154          
BLAST of FC928997 vs. ExPASy Swiss-Prot
Match: HSP18_ORYSJ (18.0 kDa class II heat shock protein OS=Oryza sativa subsp. japonica GN=HSP18.0 PE=2 SV=1)

HSP 1 Score: 181.03 bits (458), Expect = 5.742e-45
Identity = 95/167 (56.89%), Postives = 127/167 (76.05%), Query Frame = 2
Query:    8 MDFRIMGLDSSPLFSTLQHMMEM--GADDSADNK-SSNAPTRTYVRDAKAMAATPADVKEYPNSYVFIVDMPGLKSGDIKVQVEDDNVLLISGERKR----EEEKDGAKYVRMERRVGKFMRKFVLPENANVEAISAVCQDGVLTVTVDXXXXXXXXXXXTIEVKIA 487
            M+  + GL++ PL + LQH++++  G   +A  + ++  PTR YVRDA+AMAATPADVK+ P +Y F+VDMPGLKS DIKVQVE++ +L+ISGER+R    EE+++  KY+RMERR+GKFMRKFVLP+NA+V+ ISAVCQDGVLTVTV+           TIEVK+A
Sbjct:    1 MESAMFGLET-PLMTALQHLLDIPDGEGGAAGKQGATGGPTRAYVRDARAMAATPADVKDLPGAYAFVVDMPGLKSSDIKVQVEEERLLVISGERRRGGGEEEKEESCKYLRMERRMGKFMRKFVLPDNADVDKISAVCQDGVLTVTVEKLPPPEPKKPKTIEVKVA 166          
The following BLAST results are available for this feature:
BLAST of FC928997 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 56
Match NameE-valueIdentityDescription
HSP21_SOYBN6.106e-6375.6317.9 kDa class II heat shock protein OS=Glycine ma... [more]
HSP21_SOLPE2.565e-6173.7517.3 kDa class II heat shock protein OS=Solanum pe... [more]
HSP21_PEA2.485e-5672.2617.1 kDa class II heat shock protein OS=Pisum sati... [more]
HSP21_IPONI1.154e-5371.2517.2 kDa class II heat shock protein OS=Ipomoea ni... [more]
HSP21_HELAN4.105e-5165.6117.9 kDa class II heat shock protein OS=Helianthus... [more]
HSP22_IPONI6.554e-4962.8718.8 kDa class II heat shock protein OS=Ipomoea ni... [more]
HSP22_MAIZE5.548e-4859.3917.8 kDa class II heat shock protein OS=Zea mays P... [more]
HSP21_MAIZE4.697e-4760.1217.5 kDa class II heat shock protein OS=Zea mays P... [more]
HSP23_MAIZE5.742e-4558.1317.0 kDa class II heat shock protein OS=Zea mays G... [more]
HSP18_ORYSJ5.742e-4556.8918.0 kDa class II heat shock protein OS=Oryza sati... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAH3BG02RM1 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH3BG02, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC928997 ID=FC928997|Name=FC928997|organism=Citrus clementina|type=EST|length=740bp
CAAAAGAATGGATTTCAGAATCATGGGTTTGGACTCATCGCCACTCTTTT
CAACTCTGCAGCACATGATGGAGATGGGGGCGGACGACTCCGCTGACAAC
AAGTCATCCAACGCGCCGACGCGCACGTACGTGAGAGACGCCAAGGCAAT
GGCGGCGACGCCTGCGGACGTGAAGGAGTATCCGAACTCGTACGTGTTCA
TCGTCGATATGCCCGGACTGAAGTCGGGGGACATCAAGGTCCAAGTGGAG
GACGACAATGTGCTGCTCATAAGCGGTGAGAGGAAGCGGGAGGAGGAGAA
AGATGGGGCCAAGTATGTGAGAATGGAGAGGAGGGTTGGCAAGTTTATGA
GGAAATTTGTGCTGCCTGAGAATGCTAACGTTGAAGCCATTTCGGCGGTG
TGTCAGGACGGAGTGTTGACTGTGACTGTCGATAAGCTGCCACCGCCGGA
GCCCAAGAAGCCCAAGACCATTGAGGTTAAGATTGCTTGAACTTTGAGAG
AGAGAATATGCTGGATTGTGGGTGCTGATGTCTTTTCTATTTGCCGGTTG
TTATGAATAATTTTGCTTGTGGGTTTGACGGTACTATGCCTCTGTAATCT
CCTCTTCCTTTTTCTTTTTTTCTCTTTCTTCCCTTTTTTGTCCAAAATTC
TCTCTGTTCACTGGTTTGTGGTTCGGTCTTTGGCATTCCGGAAGGGAAGC
TGACGGCCGTCTACTGGTAGACATCTAGTTGTTATAATTA
back to top