FC928999

Overview
NameFC928999
Unique NameFC928999
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length377
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9282 contig Ccv1_Contig9282:1..377. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC928999 vs. ExPASy Swiss-Prot
Match: ILL4_ARATH (IAA-amino acid hydrolase ILR1-like 4 OS=Arabidopsis thaliana GN=ILL4 PE=1 SV=2)

HSP 1 Score: 203.756 bits (517), Expect = 2.337e-52
Identity = 101/124 (81.45%), Postives = 114/124 (91.94%), Query Frame = 1
Query:    4 TMLLGAAKILQEHREELKGTVVLVFQPAEEGGGGAHKVLEAGVLEKVNAIFGLHVDPNLPIGEVASRPGPLLAGSGFFEAVIGGKGGHAAIPQHSIDPILAASNVIVSLQHLVSREADPLDSQV 375
            TMLLGAAK+L+EH EEL+GTVVLVFQPAEEGGGGA K++EAGVLE V+AIFGLHV   L +G+V+SR GP+LAGSGFF+A I GKGGHAA+PQH+IDPILAASNVIVSLQHLVSREADPLDSQV
Sbjct:  141 TMLLGAAKLLKEHEEELQGTVVLVFQPAEEGGGGAKKIVEAGVLENVSAIFGLHVTNQLALGQVSSREGPMLAGSGFFKAKISGKGGHAALPQHTIDPILAASNVIVSLQHLVSREADPLDSQV 264          
BLAST of FC928999 vs. ExPASy Swiss-Prot
Match: ILL1_ORYSJ (IAA-amino acid hydrolase ILR1-like 1 OS=Oryza sativa subsp. japonica GN=ILL1 PE=2 SV=1)

HSP 1 Score: 199.134 bits (505), Expect = 5.755e-51
Identity = 98/125 (78.40%), Postives = 112/125 (89.60%), Query Frame = 1
Query:    1 VTMLLGAAKILQEHREELKGTVVLVFQPAEEGGGGAHKVLEAGVLEKVNAIFGLHVDPNLPIGEVASRPGPLLAGSGFFEAVIGGKGGHAAIPQHSIDPILAASNVIVSLQHLVSREADPLDSQV 375
            V MLLG+A+ILQEHR+ELKGTVVLVFQPAEEGGGGA K+++ G +E + AIFG+HV   +PIG VASRPGP++AGSGFFEAVI GKGGHAA+P H+IDPILAASNVIVSLQ LVSREADPLDSQV
Sbjct:  141 VAMLLGSARILQEHRDELKGTVVLVFQPAEEGGGGAKKMIDDGAVENIEAIFGVHVADVVPIGVVASRPGPVMAGSGFFEAVISGKGGHAALPHHTIDPILAASNVIVSLQQLVSREADPLDSQV 265          
BLAST of FC928999 vs. ExPASy Swiss-Prot
Match: ILL1_ORYSI (IAA-amino acid hydrolase ILR1-like 1 OS=Oryza sativa subsp. indica GN=ILL1 PE=2 SV=1)

HSP 1 Score: 199.134 bits (505), Expect = 5.755e-51
Identity = 98/125 (78.40%), Postives = 112/125 (89.60%), Query Frame = 1
Query:    1 VTMLLGAAKILQEHREELKGTVVLVFQPAEEGGGGAHKVLEAGVLEKVNAIFGLHVDPNLPIGEVASRPGPLLAGSGFFEAVIGGKGGHAAIPQHSIDPILAASNVIVSLQHLVSREADPLDSQV 375
            V MLLG+A+ILQEHR+ELKGTVVLVFQPAEEGGGGA K+++ G +E + AIFG+HV   +PIG VASRPGP++AGSGFFEAVI GKGGHAA+P H+IDPILAASNVIVSLQ LVSREADPLDSQV
Sbjct:  141 VAMLLGSARILQEHRDELKGTVVLVFQPAEEGGGGAKKMIDDGTVENIEAIFGVHVADVVPIGVVASRPGPVMAGSGFFEAVISGKGGHAALPHHTIDPILAASNVIVSLQQLVSREADPLDSQV 265          
BLAST of FC928999 vs. ExPASy Swiss-Prot
Match: ILL5_ARATH (IAA-amino acid hydrolase ILR1-like 5 OS=Arabidopsis thaliana GN=ILL5 PE=3 SV=1)

HSP 1 Score: 187.193 bits (474), Expect = 2.263e-47
Identity = 93/124 (75.00%), Postives = 110/124 (88.71%), Query Frame = 1
Query:    4 TMLLGAAKILQEHREELKGTVVLVFQPAEEGGGGAHKVLEAGVLEKVNAIFGLHVDPNLPIGEVASRPGPLLAGSGFFEAVIGGKGGHAAIPQHSIDPILAASNVIVSLQHLVSREADPLDSQV 375
            TMLLGAAK+L+EH+EEL+GTV+LVFQPAEEGG GA K++EAGVLE V AIFGLHV   L +G+++SR G L+AGSG F+A I GKGGHAA+PQ +IDP+LAASNVI+SLQHLVSREADPLDSQV
Sbjct:  141 TMLLGAAKLLKEHQEELQGTVILVFQPAEEGGAGAKKIVEAGVLENVGAIFGLHVSNLLGLGQLSSREGLLMAGSGRFKATISGKGGHAALPQFAIDPVLAASNVILSLQHLVSREADPLDSQV 264          
BLAST of FC928999 vs. ExPASy Swiss-Prot
Match: ILL2_ARATH (IAA-amino acid hydrolase ILR1-like 2 OS=Arabidopsis thaliana GN=ILL2 PE=1 SV=2)

HSP 1 Score: 174.096 bits (440), Expect = 1.983e-43
Identity = 85/125 (68.00%), Postives = 102/125 (81.60%), Query Frame = 1
Query:    1 VTMLLGAAKILQEHREELKGTVVLVFQPAEEGGGGAHKVLEAGVLEKVNAIFGLHVDPNLPIGEVASRPGPLLAGSGFFEAVIGGKGGHAAIPQHSIDPILAASNVIVSLQHLVSREADPLDSQV 375
            VTMLLGAAKIL EHR  L+GTVVL+FQPAEEG  GA K+ E G L+ V AIFG+H+   +P G+ ASR G  LAG+G FEAVI GKGGHAAIPQH+IDP++AAS++++SLQ LVSRE DPLDS+V
Sbjct:  143 VTMLLGAAKILHEHRHHLQGTVVLIFQPAEEGLSGAKKMREEGALKNVEAIFGIHLSARIPFGKAASRAGSFLAGAGVFEAVITGKGGHAAIPQHTIDPVVAASSIVLSLQQLVSRETDPLDSKV 267          
BLAST of FC928999 vs. ExPASy Swiss-Prot
Match: ILL2_ORYSJ (IAA-amino acid hydrolase ILR1-like 2 OS=Oryza sativa subsp. japonica GN=ILL2 PE=2 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 7.534e-43
Identity = 87/124 (70.16%), Postives = 101/124 (81.45%), Query Frame = 1
Query:    4 TMLLGAAKILQEHREELKGTVVLVFQPAEEGGGGAHKVLEAGVLEKVNAIFGLHVDPNLPIGEVASRPGPLLAGSGFFEAVIGGKGGHAAIPQHSIDPILAASNVIVSLQHLVSREADPLDSQV 375
            TMLLGAA+ILQE R EL+GTVVL+FQP EE G GA +++EAG ++ V AIFG HV   LP G V SRPGPLLAG GFFEAVI GKGGHAA P  S+DPILAAS V+++LQ LVSREADPL++QV
Sbjct:  156 TMLLGAARILQERRHELQGTVVLLFQPGEEVGTGARRMVEAGAVDNVEAIFGFHVSVELPTGVVGSRPGPLLAGCGFFEAVITGKGGHAAHPHASVDPILAASTVVLALQGLVSREADPLEAQV 279          
BLAST of FC928999 vs. ExPASy Swiss-Prot
Match: ILL1_ARATH (IAA-amino acid hydrolase ILR1-like 1 OS=Arabidopsis thaliana GN=ILL1 PE=1 SV=1)

HSP 1 Score: 170.244 bits (430), Expect = 2.863e-42
Identity = 82/125 (65.60%), Postives = 101/125 (80.80%), Query Frame = 1
Query:    1 VTMLLGAAKILQEHREELKGTVVLVFQPAEEGGGGAHKVLEAGVLEKVNAIFGLHVDPNLPIGEVASRPGPLLAGSGFFEAVIGGKGGHAAIPQHSIDPILAASNVIVSLQHLVSREADPLDSQV 375
            V MLLGAAKILQ+HR+ L+GTVVL+FQPAEEG  GA  + E G L+ V AIFG+H+ P  P G+ AS  G  +AG+G FEAVI GKGGHAAIPQH+IDP++AAS++++SLQHLVSRE DP DS+V
Sbjct:  142 VAMLLGAAKILQQHRQHLQGTVVLIFQPAEEGLSGAKMMREEGALKNVEAIFGIHLSPRTPFGKAASLAGSFMAGAGAFEAVITGKGGHAAIPQHTIDPVVAASSIVLSLQHLVSRETDPSDSKV 266          
BLAST of FC928999 vs. ExPASy Swiss-Prot
Match: ILL8_ORYSJ (IAA-amino acid hydrolase ILR1-like 8 OS=Oryza sativa subsp. japonica GN=ILL8 PE=2 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 7.796e-40
Identity = 76/125 (60.80%), Postives = 99/125 (79.20%), Query Frame = 1
Query:    1 VTMLLGAAKILQEHREELKGTVVLVFQPAEEGGGGAHKVLEAGVLEKVNAIFGLHVDPNLPIGEVASRPGPLLAGSGFFEAVIGGKGGHAAIPQHSIDPILAASNVIVSLQHLVSREADPLDSQV 375
            VTMLLGAAK+LQ  ++ELKGT+ LVFQPAEEG  GA+ VLE+G+L+ V+ IFGLHV PNLP+G VASRPGP ++ +  F A   GKGGHA +P  ++DP++A S+ ++SLQ LVSRE DPL++ V
Sbjct:  151 VTMLLGAAKLLQSRKDELKGTIKLVFQPAEEGHAGAYHVLESGLLDDVSVIFGLHVIPNLPVGVVASRPGPFMSAAARFAATFTGKGGHAGVPHDAVDPVVAVSSAVLSLQQLVSRETDPLEAAV 275          
BLAST of FC928999 vs. ExPASy Swiss-Prot
Match: ILL7_ORYSJ (IAA-amino acid hydrolase ILR1-like 7 OS=Oryza sativa subsp. japonica GN=ILL7 PE=2 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 7.796e-40
Identity = 81/124 (65.32%), Postives = 98/124 (79.03%), Query Frame = 1
Query:    4 TMLLGAAKILQEHREELKGTVVLVFQPAEEGGGGAHKVLEAGVLEKVNAIFGLHVDPNLPIGEVASRPGPLLAGSGFFEAVIGGKGGHAAIPQHSIDPILAASNVIVSLQHLVSREADPLDSQV 375
            TMLLGAAK+LQ  +++LKGTV LVFQPAEEG  GA  VL+ GVL+ V+AIFGLHVDP + +G V SRPGP LA SG F A I GKGGHAA P +++DPIL AS+ IVSLQ +V+RE DPL++ V
Sbjct:  163 TMLLGAAKLLQSQKDDLKGTVKLVFQPAEEGYAGARYVLQEGVLDDVSAIFGLHVDPRIQVGTVTSRPGPFLAASGRFLATITGKGGHAAGPHNAVDPILTASSAIVSLQQIVARETDPLEAAV 286          
BLAST of FC928999 vs. ExPASy Swiss-Prot
Match: ILL9_ORYSJ (IAA-amino acid hydrolase ILR1-like 9 OS=Oryza sativa subsp. japonica GN=ILL9 PE=2 SV=2)

HSP 1 Score: 161.77 bits (408), Expect = 1.018e-39
Identity = 80/123 (65.04%), Postives = 97/123 (78.86%), Query Frame = 1
Query:    7 MLLGAAKILQEHREELKGTVVLVFQPAEEGGGGAHKVLEAGVLEKVNAIFGLHVDPNLPIGEVASRPGPLLAGSGFFEAVIGGKGGHAAIPQHSIDPILAASNVIVSLQHLVSREADPLDSQV 375
            MLLGAAK+LQ+ + ELKGTV LVFQPAEEG  GA+ VL+ GVL+ V+A+FG+HVDP LP+G VA+RPGP  A SG F A I GKGGHAA P  +IDP++AASN I+SLQ +V+RE DPL   V
Sbjct:  149 MLLGAAKLLQKRKNELKGTVKLVFQPAEEGSAGAYYVLQEGVLDDVSAMFGMHVDPALPVGVVAARPGPFAATSGRFLATITGKGGHAAFPHDAIDPVVAASNAILSLQQIVAREIDPLQGAV 271          
The following BLAST results are available for this feature:
BLAST of FC928999 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 101
Match NameE-valueIdentityDescription
ILL4_ARATH2.337e-5281.45IAA-amino acid hydrolase ILR1-like 4 OS=Arabidopsi... [more]
ILL1_ORYSJ5.755e-5178.40IAA-amino acid hydrolase ILR1-like 1 OS=Oryza sati... [more]
ILL1_ORYSI5.755e-5178.40IAA-amino acid hydrolase ILR1-like 1 OS=Oryza sati... [more]
ILL5_ARATH2.263e-4775.00IAA-amino acid hydrolase ILR1-like 5 OS=Arabidopsi... [more]
ILL2_ARATH1.983e-4368.00IAA-amino acid hydrolase ILR1-like 2 OS=Arabidopsi... [more]
ILL2_ORYSJ7.534e-4370.16IAA-amino acid hydrolase ILR1-like 2 OS=Oryza sati... [more]
ILL1_ARATH2.863e-4265.60IAA-amino acid hydrolase ILR1-like 1 OS=Arabidopsi... [more]
ILL8_ORYSJ7.796e-4060.80IAA-amino acid hydrolase ILR1-like 8 OS=Oryza sati... [more]
ILL7_ORYSJ7.796e-4065.32IAA-amino acid hydrolase ILR1-like 7 OS=Oryza sati... [more]
ILL9_ORYSJ1.018e-3965.04IAA-amino acid hydrolase ILR1-like 9 OS=Oryza sati... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAH3BG06RM1 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH3BG06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC928999 ID=FC928999|Name=FC928999|organism=Citrus clementina|type=EST|length=377bp
GTCACCATGCTTCTAGGTGCAGCAAAAATTCTTCAAGAGCACCGTGAGGA
GTTAAAGGGTACAGTTGTTCTGGTTTTCCAACCAGCCGAAGAAGGAGGTG
GAGGAGCCCACAAAGTGCTCGAAGCAGGAGTCCTGGAAAAAGTTAATGCC
ATATTTGGGTTACATGTCGACCCTAACTTACCCATAGGTGAAGTAGCTTC
AAGACCTGGTCCTCTGTTAGCTGGGAGTGGCTTCTTTGAAGCAGTAATAG
GTGGAAAAGGAGGTCATGCGGCCATTCCTCAGCATTCAATAGATCCAATA
TTGGCAGCTTCTAATGTGATTGTTAGTTTACAACATCTTGTTTCTCGTGA
AGCTGATCCACTTGATTCACAGGTCGT
back to top