FC929002

Overview
NameFC929002
Unique NameFC929002
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length812
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig14291 contig Ccv1_Contig14291:279..1090. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929002 vs. ExPASy Swiss-Prot
Match: DAG_ANTMA (DAG protein, chloroplastic OS=Antirrhinum majus GN=DAG PE=2 SV=1)

HSP 1 Score: 281.567 bits (719), Expect = 3.650e-75
Identity = 131/145 (90.34%), Postives = 137/145 (94.48%), Query Frame = 3
Query:   15 EPRETIMLPGCDYNHWLIVMEFPKDPAPTREQMIETYLNTLATVLGSMEEAKKNMYAFSTTTYTGFQCTVSEETSEKFKGLPGVLWVLPDSYIDVKNKDYGGDKYVNGEIIPCTYPTYQPNKRKESKYVSKRYERRRDGPPAERR 449
            E RETIMLPGCDYNHWLIVMEFPKDPAPTREQMI+TYLNTLATVLGSMEEAKKNMYAFSTTTYTGFQCTV+EETSEKFKGLPGVLWVLPDSYIDVKNKDYGGDKYVNGEIIPC YPTYQP + + SKY SK Y R+RDGPPAE+R
Sbjct:   74 EERETIMLPGCDYNHWLIVMEFPKDPAPTREQMIDTYLNTLATVLGSMEEAKKNMYAFSTTTYTGFQCTVTEETSEKFKGLPGVLWVLPDSYIDVKNKDYGGDKYVNGEIIPCQYPTYQPKQSRSSKYKSKAYVRQRDGPPAEQR 218          
BLAST of FC929002 vs. ExPASy Swiss-Prot
Match: UMP1_ARATH (Uncharacterized protein At3g15000, mitochondrial OS=Arabidopsis thaliana GN=At3g15000 PE=1 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 2.477e-31
Identity = 69/162 (42.59%), Postives = 101/162 (62.35%), Query Frame = 3
Query:   18 PRETIMLPGCDYNHWLIVMEFPKDPAPTREQMIETYLNTLATVLGSMEEAKKNMYAFSTTTYTGFQCTVSEETSEKFKGLPGVLWVLPDSYIDVKNKDYGGDKYVNGEIIPCTYPTY---------------QPNKRKESKYVSKRYERRRD----GPPAER 446
            P+ETI+L GCD+ HWL+V+E P    PTR+++I++Y+ TLA ++GS +EA+  +Y+ ST  Y  F   VSE+ S K K L  V WVLPDSY+DV+NKDYGG+ +++G+ +P   P Y               + N R  +   S+ +ERRR+    GPP +R
Sbjct:   86 PKETILLDGCDFEHWLVVVE-PPQGEPTRDEIIDSYIKTLAQIVGSEDEARMKIYSVSTRCYYAFGALVSEDLSHKLKELSNVRWVLPDSYLDVRNKDYGGEPFIDGKAVPYD-PKYHEEWIRNNARANERNRRNDRPRNNDRSRNFERRRENMAGGPPPQR 245          
The following BLAST results are available for this feature:
BLAST of FC929002 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
DAG_ANTMA3.650e-7590.34DAG protein, chloroplastic OS=Antirrhinum majus GN... [more]
UMP1_ARATH2.477e-3142.59Uncharacterized protein At3g15000, mitochondrial O... [more]
back to top
Properties
Property NameValue
Genbank descriptionKN0AAH3BG10RM1 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH3BG10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929002 ID=FC929002|Name=FC929002|organism=Citrus clementina|type=EST|length=812bp
GAAGCAGCATCAATGAGCCGAGGGAGACGATTATGTTACCGGGATGTGAC
TACAACCACTGGCTTATTGTCATGGAGTTCCCCAAGGACCCTGCTCCCAC
GAGAGAGCAGATGATTGAAACTTATCTCAATACTCTTGCCACTGTTCTTG
GAAGCATGGAAGAAGCAAAGAAGAATATGTATGCTTTTAGCACCACTACT
TACACTGGATTCCAATGCACAGTATCCGAAGAAACCTCAGAGAAATTCAA
AGGCCTGCCTGGTGTTCTTTGGGTGTTGCCCGATTCATACATAGATGTCA
AAAATAAAGATTATGGAGGTGATAAATATGTCAATGGAGAGATCATTCCC
TGCACATATCCCACTTATCAGCCAAACAAACGAAAAGAATCAAAATATGT
GAGCAAAAGATATGAGAGACGAAGAGATGGCCCTCCTGCTGAAAGAAGAA
CGAGACAAGCAGCTGGTCAGTCAGAATCAGCGTCGTCATAAGTTTGCGAC
TCCAAAAGCCAATCATACTACTGCCACCATGCGTATCAGCAGTCTAATCA
AGACACCTGTTTTATGAGTTCTCAAGCTGTTCTTGGTAGTTTTTGTAATG
GATATCATTTAATGTAGTTAGGATAGAAATTCTCTGGTAATCGCCATCAT
TTAGTTTTGTGCCTCTGGGCTTGTTATTTGAAATGTTGTCCACTGACATT
TCATGGTTGCCGAAGGTCTGCTGTCTATTGTCTAANAGTACTGTTGTGTC
AGATTTCTCATTTAGCTTTAATATATAAAGTTAATTTTGCCGTAAAAAAA
AAAAAAAAAAAA
back to top