FC929008

Overview
NameFC929008
Unique NameFC929008
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length800
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC929008_ssr289 microsatellite FC929008_ssr289:289..300. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig16 contig Ccv1_Contig16:604..1403. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929008 vs. ExPASy Swiss-Prot
Match: FBK15_ARATH (F-box/kelch-repeat protein At1g26930 OS=Arabidopsis thaliana GN=At1g26930 PE=2 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 1.195e-38
Identity = 73/144 (50.69%), Postives = 99/144 (68.75%), Query Frame = 1
Query:  367 SDSLLPGLVDDVALNCLAFACTSDYASLLFINKRFHKLIKSGYLYGLRKQLGIVEHWVYLVCDPRGWEAFDPMKKKWMALPKIPCDECFNHADKESLAVGSELLVFGRELFDFAIWKYSLVFRSWMKCEGMNHPRCLFGSSSLG 798
            S +L+PG+  D +L+CL     +DY S+  +N+    LI+SG +Y LR+  G +EHWVY  C    WEAFDP  K+WM LP +P +ECF +ADKESLAVG++LLVFG E+  + I++YSL+  SW   + MN PRCLFGS+S G
Sbjct:   68 SGTLIPGMNRDDSLSCLIRCSRADYCSIASVNRSLRSLIRSGEIYRLRRLQGTLEHWVYFSCHLNEWEAFDPRSKRWMHLPSMPQNECFRYADKESLAVGTDLLVFGWEVSSYVIYRYSLLTNSWSTAKSMNMPRCLFGSASYG 211          
BLAST of FC929008 vs. ExPASy Swiss-Prot
Match: FBK29_ARATH (F-box/kelch-repeat protein At1g74510 OS=Arabidopsis thaliana GN=At1g74510 PE=2 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 5.194e-34
Identity = 68/137 (49.64%), Postives = 90/137 (65.69%), Query Frame = 1
Query:  388 LVDDVALNCLAFACTSDYASLLFINKRFHKLIKSGYLYGLRKQLGIVEHWVYLVCDPRGWEAFDPMKKKWMALPKIPCDECFNHADKESLAVGSELLVFGRELFDFAIWKYSLVFRSWMKCEGMNHPRCLFGSSSLG 798
            L  +  LNCLA    SD+ S+   N+ F  LIK   LY LR+  GIVEHW+Y  C    WEA+DP   +W+ +PK+  +ECF  +DKESLAVG+ELLVFG+E+    I++YS++  +W     MN PRCLFGS+SLG
Sbjct:   99 LDQNALLNCLAHCSLSDFGSIASTNRTFRSLIKDSELYRLRRAKGIVEHWIYFSCRLLEWEAYDPNGDRWLRVPKMTFNECFMCSDKESLAVGTELLVFGKEIMSHVIYRYSILTNTWTSGMQMNVPRCLFGSASLG 235          
BLAST of FC929008 vs. ExPASy Swiss-Prot
Match: SKI11_ARATH (F-box/kelch-repeat protein SKIP11 OS=Arabidopsis thaliana GN=SKIP11 PE=1 SV=2)

HSP 1 Score: 143.665 bits (361), Expect = 1.157e-33
Identity = 73/154 (47.40%), Postives = 97/154 (62.99%), Query Frame = 1
Query:  340 NDGCCRIGPSDSLLPGLVDDVALNCLAFACTSDYASLLFINKRFHKLIKSGYLYGLRKQLGIVEHWVYLVCDPRGWEAFDPMKKKWMALPKIPCDECFNHADKESLAVGSELLVFGRELF-DFAIWKYSLVFRSWMKCEGMNHPRCLFGSSSLG 798
            ND       S SL+  +  D +++CL     SDY S+  +N+ F  L+KSG +Y LR+Q G VEHWVY  C    W AFDP++++WM LP +P    F  ADKESLAVG++LLV G++ F    I++YSL+  SW     MN PRCLFGS+SLG
Sbjct:  105 NDNGGDSSDSHSLINEIGRDNSIDCLIRCSRSDYGSIASLNRNFRSLVKSGEIYRLRRQNGFVEHWVYFSCQLLEWVAFDPVERRWMQLPTMPSSVTFMCADKESLAVGTDLLVLGKDDFSSHVIYRYSLLTNSWSSGMKMNSPRCLFGSASLG 258          
BLAST of FC929008 vs. ExPASy Swiss-Prot
Match: FBK70_ARATH (F-box/kelch-repeat protein At3g27150 OS=Arabidopsis thaliana GN=At3g27150 PE=2 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 8.051e-19
Identity = 51/141 (36.17%), Postives = 77/141 (54.61%), Query Frame = 1
Query:  379 LPGLVDDVALNCLAFACTSDYASLLFINKRFHKLIKSGYLYGLRKQLGIVEHWVYLVCD-PRGWEAFDPMKKKWMALPKIPCDECFNHADKESLAVGSELLVFGRELFDFAIWKYSLVFRSWMKCEGMNHPRCLFGSSSLG 798
            +P LV ++ +  LA     +Y  L  +NK F +L+KS  ++ +R++ G+VE  V+++      W  FD        LP++P D CF H DKESL  G+ L+V G+E    A+W+Y L    W K   M  PR LF S++ G
Sbjct:   71 VPQLVYELEVEILARVPRFEYWKLKLLNKGFSRLLKSDEIFKVRRERGVVEPSVFMLSSGDTCWTMFDKGFGNCQKLPELPSDICFLHGDKESLCAGTHLIVTGKEEKSIALWRYELETSKWFKGPAMITPRILFASATCG 211          
BLAST of FC929008 vs. ExPASy Swiss-Prot
Match: FBK22_ARATH (F-box/kelch-repeat protein At1g55270 OS=Arabidopsis thaliana GN=At1g55270 PE=2 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 6.179e-11
Identity = 39/110 (35.45%), Postives = 58/110 (52.73%), Query Frame = 1
Query:  376 LLPGLVDDVALNCLAFACTSDYASLLFINKRFHKLIKSGYLYGLRKQLGIVEHWVYLVCDPR----GWEAFDPMKKKWMALPKIPCDECFNHADKESLAV--GSELLVFG 687
            LLPGL DD+A+ CL     +++  L  + KR+++L    + Y  RK LG+ E WVY+    R     W  FDP+ + W  LP +P +  ++ A     AV  G  L +FG
Sbjct:   78 LLPGLPDDLAVACLIRVPRAEHRKLRLVCKRWYRLASGNFFYSQRKLLGMSEEWVYVFKRDRDGKISWNTFDPISQLWQPLPPVPRE--YSEAVGFGCAVLSGCHLYLFG 185          
The following BLAST results are available for this feature:
BLAST of FC929008 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 5
Match NameE-valueIdentityDescription
FBK15_ARATH1.195e-3850.69F-box/kelch-repeat protein At1g26930 OS=Arabidopsi... [more]
FBK29_ARATH5.194e-3449.64F-box/kelch-repeat protein At1g74510 OS=Arabidopsi... [more]
SKI11_ARATH1.157e-3347.40F-box/kelch-repeat protein SKIP11 OS=Arabidopsis t... [more]
FBK70_ARATH8.051e-1936.17F-box/kelch-repeat protein At3g27150 OS=Arabidopsi... [more]
FBK22_ARATH6.179e-1135.45F-box/kelch-repeat protein At1g55270 OS=Arabidopsi... [more]
back to top
Properties
Property NameValue
Genbank descriptionKN0AAH3BH05RM1 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH3BH05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929008 ID=FC929008|Name=FC929008|organism=Citrus clementina|type=EST|length=800bp
GAGAGATGGTTATAAATGAGTCATGTGCTAAGTTTTATGGAAAGAATATA
TAGGCGGAGGTTCATTGTGTGCAAAGATCGGAATTTGTTTTCTGGTTATT
GGGAGCGTCATTGAGAATTGTGGGTTGACACTTTCTTTTATCTTTTTAAA
TTTTAATCAAGATTGACTTTTTTTTTTTTATAGAAATTTTGCTTGATTTT
GTTGGATTATAGGAAAAGAATTTTTTTTCTCCCTTTTAACATGATAAAGA
AAGCGCGTTTGGATGATATTATGGAGGAAGTAGAAAAGGAAGAAGAAGAA
GCAGCTAGTTTATCAGTAGTGAGTTGGAAAGCGGGAGTGAATGATGGTTG
TTGTCGGATTGGACCAAGTGATTCACTTCTCCCTGGTCTTGTTGATGATG
TTGCTTTGAACTGTCTTGCTTTTGCATGTACATCCGACTATGCATCATTG
TTATTTATAAATAAGAGGTTTCATAAGTTAATCAAGAGTGGGTATTTGTA
TGGGTTAAGGAAGCAATTGGGTATTGTGGAGCATTGGGTCTACTTGGTTT
GTGATCCACGGGGTTGGGAGGCATTCGATCCAATGAAAAAGAAGTGGATG
GCTTTGCCTAAGATCCCTTGTGATGAGTGTTTCAACCATGCAGATAAAGA
GTCCTTGGCTGTGGGTAGTGAATTGTTGGTTTTTGGGCGTGAATTGTTTG
ATTTTGCAATTTGGAAGTATAGCTTGGTTTTCCGTAGTTGGATGAAGTGT
GAGGGAATGAACCACCCTCGTTGCTTGTTTGGCTCAAGTAGTCTTGGTTC
back to top