FC929031

Overview
NameFC929031
Unique NameFC929031
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length835
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9277 contig Ccv1_Contig9277:2..836. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929031 vs. ExPASy Swiss-Prot
Match: UPL6_ARATH (E3 ubiquitin-protein ligase UPL6 OS=Arabidopsis thaliana GN=UPL6 PE=2 SV=1)

HSP 1 Score: 489.189 bits (1258), Expect = 1.212e-137
Identity = 235/278 (84.53%), Postives = 251/278 (90.29%), Query Frame = 2
Query:    2 AFDVQYGLFKETSDHLLYPNPGSGMIHEQHLQFFHFLGILLAKAMFEGILVDIPFATFFLSKLKRKYNYLNDLPSLDPELYRHLIFLKHYEADISELELYFVILNNEYGEQTEEELLPGGKNIRVTNENVITFIHLVSNHRLNFQIRQQSSHFLRGFQQLIQKDWINMFNEHEXXXXXXXXXXXXXXXXXRQNTNYVGGYHSEHYVIEMFWEVLKSFSLENQKKFLKFVTGCSRGPLLGFKYLEPLFCIQRAAGSASEEALDRLPTSATCMNLLKLPP 835
            AFDVQYGLFKET+DH+LYPNPGSGMIHEQHLQFFHFLG LLAKAMFEGILVDIPFATFFLSKLK+KYNYLNDLPSLDPELYRHLIFLK Y+ DIS+LELYFVILNNEYGE+TEEELLPGG+++RVTNENVITFIHLVSNHRLNFQIRQQSSHFLRGFQQLI K+WI+MFNEHE                 R NTNY GGYH+ HYVI+MFWEV+KSFS ENQKKFLKFVTGCSRGPLLGFKYLEP FCIQRAAGSAS E++DRLPTSATCMNLLKLPP
Sbjct:  728 AFDVQYGLFKETADHMLYPNPGSGMIHEQHLQFFHFLGSLLAKAMFEGILVDIPFATFFLSKLKQKYNYLNDLPSLDPELYRHLIFLKRYKGDISDLELYFVILNNEYGERTEEELLPGGQDMRVTNENVITFIHLVSNHRLNFQIRQQSSHFLRGFQQLIPKEWIDMFNEHELQVLISGSVDSLDIDDLRNNTNYAGGYHAGHYVIDMFWEVMKSFSTENQKKFLKFVTGCSRGPLLGFKYLEPAFCIQRAAGSASNESVDRLPTSATCMNLLKLPP 1005          
BLAST of FC929031 vs. ExPASy Swiss-Prot
Match: UBE3C_HUMAN (Ubiquitin-protein ligase E3C OS=Homo sapiens GN=UBE3C PE=1 SV=3)

HSP 1 Score: 242.276 bits (617), Expect = 2.581e-63
Identity = 127/279 (45.52%), Postives = 178/279 (63.80%), Query Frame = 2
Query:    5 FDVQYGLFKETSDHLLYPNPGSGM-IHEQHLQFFHFLGILLAKAMFEGILVDIPFATFFLSKLKRKYNY--LNDLPSLDPELYRHLIFLKHYEADISELELYFVILNNEYGEQTEEELLPGGKNIRVTNENVITFIHLVSNHRLNFQIRQQSSHFLRGFQQLIQKDWINMFNEHEXXXXXXXXXXXXXXXXXRQNTNYVGGYHSEHYVIEMFWEVLKSFSLENQKKFLKFVTGCSRGPLLGFKYLEPLFCIQRAAGSASEEALDRLPTSATCMNLLKLP 832
            F+   G FK T++ LLYPNP + M + +   + ++FLG +L KA++E +LV++PFA FFLSKL        ++ L SLDPE+Y++L+FLK YE D+ EL L F ++NN+ GE    EL  GGK+I VT+ N I +IHLV+++RLN QIRQ    F +G   ++  +W+ MF++ E                 +  TNY GGY ++H VI++FW V++ F+ E ++K LKFVT CSR PLLGFK L P FCI           L+RLPT++TCMNLLKLP
Sbjct:  785 FNPNQGFFKTTNEGLLYPNPAAQMLVGDSFARHYYFLGRMLGKALYENMLVELPFAGFFLSKLLGTSADVDIHHLASLDPEVYKNLLFLKSYEDDVEELGLNFTVVNNDLGEAQVVELKFGGKDIPVTSANRIAYIHLVADYRLNRQIRQHCLAFRQGLANVVSLEWLRMFDQQEIQVLISGAQVPISLEDLKSFTNYSGGYSADHPVIKVFWRVVEGFTDEEKRKLLKFVTSCSRPPLLGFKELYPAFCIHNGGSD-----LERLPTASTCMNLLKLP 1058          
BLAST of FC929031 vs. ExPASy Swiss-Prot
Match: UBE3C_MOUSE (Ubiquitin-protein ligase E3C OS=Mus musculus GN=Ube3c PE=2 SV=2)

HSP 1 Score: 241.121 bits (614), Expect = 5.749e-63
Identity = 127/279 (45.52%), Postives = 176/279 (63.08%), Query Frame = 2
Query:    5 FDVQYGLFKETSDHLLYPNPGSGM-IHEQHLQFFHFLGILLAKAMFEGILVDIPFATFFLSKLKRKYNY--LNDLPSLDPELYRHLIFLKHYEADISELELYFVILNNEYGEQTEEELLPGGKNIRVTNENVITFIHLVSNHRLNFQIRQQSSHFLRGFQQLIQKDWINMFNEHEXXXXXXXXXXXXXXXXXRQNTNYVGGYHSEHYVIEMFWEVLKSFSLENQKKFLKFVTGCSRGPLLGFKYLEPLFCIQRAAGSASEEALDRLPTSATCMNLLKLP 832
            F+   G FK T++ LLYPNP + M + +   + ++FLG +L KA++E +LV++PFA FFLSKL        ++ L SLDPE+YR+L+FLK YE D+ EL L F ++NN+ GE    EL  GGK+I VT  N I +IHLV+++RLN QIR     F +G   ++  +W+ MF++ E                 +  TNY GGY ++H VI++FW V++ F+ E ++K LKFVT CSR PLLGFK L P FCI           L+RLPT++TCMNLLKLP
Sbjct:  785 FNPNQGFFKTTNEGLLYPNPAAQMLVGDSFARHYYFLGRMLGKALYENMLVELPFAGFFLSKLLGTSADVDIHHLASLDPEVYRNLLFLKSYEEDVEELGLNFTVVNNDLGEAQVVELKFGGKDIPVTGANRIAYIHLVADYRLNKQIRPHCLAFRQGLANVVSLEWLRMFDQQEIQVLISGAQVPVSLEDLKSFTNYSGGYSADHPVIKIFWRVVEGFTDEEKRKLLKFVTSCSRPPLLGFKELYPAFCIHNGGSD-----LERLPTASTCMNLLKLP 1058          
BLAST of FC929031 vs. ExPASy Swiss-Prot
Match: YFK7_SCHPO (Probable E3 ubiquitin protein ligase C167.07c OS=Schizosaccharomyces pombe GN=SPAC167.07c PE=2 SV=1)

HSP 1 Score: 237.269 bits (604), Expect = 8.301e-62
Identity = 120/277 (43.32%), Postives = 173/277 (62.45%), Query Frame = 2
Query:    5 FDVQYGLFKETSDHLLYPNPGSGMIHEQHLQFFHFLGILLAKAMFEGILVDIPFATFFLSKLKRKYNYLNDLPSLDPELYRHLIFLKHYEADI-SELELYFVILNNEYGEQTEEELLPGGKNIRVTNENVITFIHLVSNHRLNFQIRQQSSHFLRGFQQLIQKDWINMFNEHEXXXXXXXXXXXXXXXXXRQNTNYVGGYHSEHYVIEMFWEVLKSFSLENQKKFLKFVTGCSRGPLLGFKYLEPLFCIQRAAGSASEEALDRLPTSATCMNLLKLP 832
            FD+ YGLF ET  HLLYPN  +     + L+ + FLG+L+ K ++EGI +D  FA+FF++K     +Y +DL SLDP LY  L+FLK+Y+ D+ +++ L F +++ E+G +   +L+P G NI VTNEN + +IHLVSN+ LN ++ +Q   F  GF Q+I   W+ MF+E E                 R++T Y GGY      I +FWEVL+ F  E+++ F+KFVT  +R P+LGFK L P FCI+      + E   RLPT++TC+NLLKLP
Sbjct:  733 FDINYGLFSETKAHLLYPNTHAYAQDVERLRCYEFLGMLIGKCIYEGIQIDAAFASFFVAKWLGHPSYFDDLTSLDPNLYEGLVFLKNYDGDVENDMALNFTVVHEEFGVRNVIDLIPNGSNISVTNENRLQYIHLVSNYYLNARLSRQCRAFTNGFTQIIDPHWLAMFHESEIQILVGGDPVPIDIDDLRRHTVYAGGYEPNSPTIVLFWEVLREFEEEDKRSFVKFVTSVARPPILGFKALMPSFCIR-----VNGEDETRLPTASTCVNLLKLP 1004          
BLAST of FC929031 vs. ExPASy Swiss-Prot
Match: UPL7_ARATH (E3 ubiquitin-protein ligase UPL7 OS=Arabidopsis thaliana GN=UPL7 PE=2 SV=1)

HSP 1 Score: 231.876 bits (590), Expect = 3.488e-60
Identity = 120/285 (42.11%), Postives = 173/285 (60.70%), Query Frame = 2
Query:    2 AFDVQYGLFKET--SDHLLYPNPGSGMIHEQHLQFFHFLGILLAKAMFEGILVDIPFATFFLSKLKRKYNYLNDLPSLDPELYRHLIFLKHYEADISELELYFVILNNEYGEQTEEELLPGGKNIRVTNENVITFIHLVSNHRLNFQIRQQSSHFLRGFQQLIQKDWINMFNEHEXXXXXXXXXXXXXXXXXRQNTNYVGGYHSEHYVIEMFWEVLKSFSLENQKKFLKFVTGCSRGPLLGFKYLEPLFCIQRAAGSAS------EEALDRLPTSATCMNLLKLP 832
            AF  +YGLF +T  SD LL P+P +  + E  +Q   FLG ++ KA++EGIL+D  F+  F+ KL  +Y+++++L  LDPELYR+L+++KHY+ D+ EL L F +     G+ +  EL PGGK+  VTNEN + +IH +++++LN QI   S+ F RG   LI   W+ +FN HE                 R+NT Y GGY      I++FWEV+K F    +   LKFVT CSR PLLGFKYL+P F I + +   S       + ++RLP+++TC N LKLP
Sbjct:  834 AFATEYGLFSQTPTSDRLLVPSPSARHL-ENGIQMIEFLGRIVGKALYEGILLDYSFSHVFIQKLLGRYSFIDELSGLDPELYRNLMYVKHYDGDLKELCLDFTVTEEFCGKMSIIELKPGGKDTSVTNENKMQYIHAMADYKLNRQIVPFSNAFYRGLTDLISPAWLKLFNAHEFNQLLSGGNHDIDVDDLRRNTKYTGGYSDSSRTIKIFWEVMKGFEPSERCLLLKFVTSCSRAPLLGFKYLQPTFIIHKVSCDTSLWAAIGGQDVERLPSASTCYNTLKLP 1117          
BLAST of FC929031 vs. ExPASy Swiss-Prot
Match: UBE3B_XENTR (Ubiquitin-protein ligase E3B OS=Xenopus tropicalis GN=ube3b PE=2 SV=1)

HSP 1 Score: 225.713 bits (574), Expect = 2.500e-58
Identity = 129/302 (42.72%), Postives = 179/302 (59.27%), Query Frame = 2
Query:    5 FDVQYGLFKETSD-HLLYPNPGSGMIHEQHLQFFHFLGILLAKAMFEGILVDIPFATFFLSKLKRK-----YNYLNDLPSLDPELYRHLIFLKHYEADISELELYFVILNNEYGEQTEEELLPGGKNIRVTNENVITFIHLVSNHRLNFQIRQQSSHFLRGFQQLIQKDWINMFNEHEXXXXXXXXXXXXXXXXXRQNTNYVGGYHSEHYVIEMFWEVL-KSFSLENQKKFLKFVTGCSRGPLLGFKYLEPLFCIQRAAGSASEEALD-------------------RLPTSATCMNLLKLP 832
            FD    LFK TS    LYP+P S  IHE +LQ F F+G +L KA++EGI+VD+PFA+FFLS+L        Y+ +++LPSLD E Y++L  +K Y+ DIS+L L      +  G+    EL+PGGK+I VTNEN I++IHL+++ R++ QI+ Q+  F+ GF+ +I+ +WI MF+  E                 +++T Y GG+H  H VI   W++L   FS E +  FLKFVT CSR PLLGF YL+P F I+    S  ++  D                   RLPTS+TC NLLKLP
Sbjct:  747 FDPALNLFKTTSSGDRLYPSPTS-YIHENYLQLFEFVGKMLGKAVYEGIVVDVPFASFFLSQLLGHHHSIFYSSVDELPSLDSEFYKNLTSIKRYDGDISDLGLTLSYDEDVMGQLVCHELVPGGKSIPVTNENKISYIHLMAHFRMHTQIKNQTVAFISGFRSIIRPEWIRMFSAPELQRLISGDNAEIDLDDLKKHTVYYGGFHGSHRVIIWLWDILANDFSSEEKAMFLKFVTSCSRPPLLGFAYLKPPFSIRCVEVSDDQDTGDTLGSVLRGFFTIRKKEPGGRLPTSSTCFNLLKLP 1047          
BLAST of FC929031 vs. ExPASy Swiss-Prot
Match: UBE3B_HUMAN (Ubiquitin-protein ligase E3B OS=Homo sapiens GN=UBE3B PE=1 SV=2)

HSP 1 Score: 224.557 bits (571), Expect = 5.568e-58
Identity = 127/302 (42.05%), Postives = 180/302 (59.60%), Query Frame = 2
Query:    5 FDVQYGLFKETS-DHLLYPNPGSGMIHEQHLQFFHFLGILLAKAMFEGILVDIPFATFFLSKLKRK-----YNYLNDLPSLDPELYRHLIFLKHYEADISELELYFVILNNEYGEQTEEELLPGGKNIRVTNENVITFIHLVSNHRLNFQIRQQSSHFLRGFQQLIQKDWINMFNEHEXXXXXXXXXXXXXXXXXRQNTNYVGGYHSEHYVIEMFWEVLKS-FSLENQKKFLKFVTGCSRGPLLGFKYLEPLFCIQRAAGSASEEALD-------------------RLPTSATCMNLLKLP 832
            FD    LFK TS D  LYP+P S  IHE +LQ F F+G +L KA++EGI+VD+PFA+FFLS+L        Y+ +++LPSLD E Y++L  +K Y+ DI++L L      +  G+    EL+PGGK I VTNEN I++IHL+++ R++ QI+ Q++  + GF+ +I+ +WI MF+  E                 +++T Y GG+H  H VI   W++L S F+ + +  FLKFVT CSR PLLGF YL+P F I+    S  ++  D                   RLPTS+TC NLLKLP
Sbjct:  743 FDPALNLFKTTSGDERLYPSPTS-YIHENYLQLFEFVGKMLGKAVYEGIVVDVPFASFFLSQLLGHHHSVFYSSVDELPSLDSEFYKNLTSIKRYDGDITDLGLTLSYDEDVMGQLVCHELIPGGKTIPVTNENKISYIHLMAHFRMHTQIKNQTAALISGFRSIIKPEWIRMFSTPELQRLISGDNAEIDLEDLKKHTVYYGGFHGSHRVIIWLWDILASDFTPDERAMFLKFVTSCSRPPLLGFAYLKPPFSIRCVEVSDDQDTGDTLGSVLRGFFTIRKREPGGRLPTSSTCFNLLKLP 1043          
BLAST of FC929031 vs. ExPASy Swiss-Prot
Match: UBE3B_MOUSE (Ubiquitin-protein ligase E3B OS=Mus musculus GN=Ube3b PE=2 SV=3)

HSP 1 Score: 222.631 bits (566), Expect = 2.116e-57
Identity = 126/302 (41.72%), Postives = 180/302 (59.60%), Query Frame = 2
Query:    5 FDVQYGLFKETS-DHLLYPNPGSGMIHEQHLQFFHFLGILLAKAMFEGILVDIPFATFFLSKLKRK-----YNYLNDLPSLDPELYRHLIFLKHYEADISELELYFVILNNEYGEQTEEELLPGGKNIRVTNENVITFIHLVSNHRLNFQIRQQSSHFLRGFQQLIQKDWINMFNEHEXXXXXXXXXXXXXXXXXRQNTNYVGGYHSEHYVIEMFWEVLKS-FSLENQKKFLKFVTGCSRGPLLGFKYLEPLFCIQRAAGSASEEALD-------------------RLPTSATCMNLLKLP 832
            FD    LFK TS D  LYP+P S  IHE +LQ F F+G +L KA++EGI+VD+PFA+FFLS++        Y+ +++LPSLD E Y++L  +K Y+ DI++L L      +  G+    EL+PGGK I VT+EN I++IHL+++ R++ QI+ Q++  + GF+ +I+ +WI MF+  E                 +++T Y GG+H  H VI   W++L S F+ E +  FLKFVT CSR PLLGF YL+P F I+    S  ++  D                   RLPTS+TC NLLKLP
Sbjct:  745 FDPALNLFKTTSGDERLYPSPTS-YIHENYLQLFEFVGKMLGKAVYEGIVVDVPFASFFLSQMLGHHHSVFYSSVDELPSLDSEFYKNLTSIKRYDGDIADLGLTLSYDEDVMGQLVCHELVPGGKTIPVTDENKISYIHLMAHFRMHTQIKNQTAALISGFRSIIKPEWIRMFSTPELQRLISGDNAEIDLEDLKKHTVYYGGFHGSHRVIIWLWDILASDFTPEERAMFLKFVTSCSRPPLLGFAYLKPPFSIRCVEVSDDQDTGDTLGSVLRGFFTIRKREPGGRLPTSSTCFNLLKLP 1045          
BLAST of FC929031 vs. ExPASy Swiss-Prot
Match: NEDD4_DROME (E3 ubiquitin-protein ligase Nedd-4 OS=Drosophila melanogaster GN=Nedd4 PE=1 SV=2)

HSP 1 Score: 165.622 bits (418), Expect = 3.070e-40
Identity = 103/284 (36.27%), Postives = 154/284 (54.23%), Query Frame = 2
Query:    5 FDVQYGLFKETS--DHLLYPNPGSGMIHEQHLQFFHFLGILLAKAMFEGILVDIPFATFFLSKLKRKYNYLNDLPSLDPELYRHLIFLKHYEADISELELYFVILNNEYGEQTEEELLPGGKNIRVTNENVITFIHLVSNHRLNFQIRQQSSHFLRGFQQLIQKDWINMFNEHEXXXXXXXXXXXXXXXXXRQNTNYVGGYHSEHYVIEMFWEVLKSFSLENQKKFLKFVTGCSRGPLLGFKYL-----EPLFCIQRAAGSASEEALDRLPTSATCMNLLKLPP 835
            F+  YGLF+ ++  ++ L  N GSG+ +E+HL +F F+G +   A++ G L+D  F   F   + +K   L D+ S+D E Y  L+++K  E D   LEL F +  + +G++++ EL PGG NI VTNEN   +I LV   R   ++++Q S FL GF  +I  + I +F+EHE                 R+NT Y G YH  H +I+ FW  + SFS E + + L+FVTG SR P+ GFK L       +F I++          +  P + TC N L LPP
Sbjct:  708 FNPYYGLFEYSAMDNYTLQINNGSGLCNEEHLSYFKFIGRIAGMAVYHGKLLDAFFIRPFYKMMLQKPIDLKDMESVDTEYYNSLMWIK--ENDPRILELTFCLDEDVFGQKSQHELKPGGANIDVTNENKDEYIKLVIEWRFVARVKEQMSSFLDGFGSIIPLNLIKIFDEHE-LELLMCGIQNIDVKDWRENTLYKGDYHMNHIIIQWFWRAVLSFSNEMRSRLLQFVTGTSRVPMNGFKELYGSNGPQMFTIEKWG------TPNNFPRAHTCFNRLDLPP 982          
BLAST of FC929031 vs. ExPASy Swiss-Prot
Match: UPL1_ARATH (E3 ubiquitin-protein ligase UPL1 OS=Arabidopsis thaliana GN=UPL1 PE=1 SV=3)

HSP 1 Score: 154.836 bits (390), Expect = 5.418e-37
Identity = 103/274 (37.59%), Postives = 156/274 (56.93%), Query Frame = 2
Query:   38 SDHLLYPNPGSGMIHEQHLQFFHFLGILLAKAMFEGILVDIPFA-TFFLSKLKRKYNYLNDLPSLDPELYRHLIFLKHYEADISE-LELYFVI-------LNNEYGEQTEEELLPGGKNIRVTNENVITFIHLVSNHRLNFQIRQQSSHFLRGFQQLIQKDWINMFNEHEXXXXXXXXXXXXXXXXXRQNTNYVGGYHSEHYVIEMFWEVLKSFSLENQKKFLKFVTGCSRGPLLGFKYLEPLFCIQRAAGSASEEALDRLPTSATCMNLLKLP 832
            +D    PNP S +   +HL +F F+G ++AKA+F+G L+D+ F  +F+   L  K  Y +D+ ++DP+ Y++L +L   E D+S+ L+L F +       +  E  E T+ EL PGG+NIRVT E    ++ LV+ H L   IR Q + FL GF +LI ++ +++FN+ E                 + NT Y   Y +   VI  FWEV+K+FS E+  +FL+FVTG S+ PL GFK L+ +   QR     +  A +RLP++ TC N L LP
Sbjct: 3388 NDATFQPNPNS-VYQTEHLSYFKFVGRMVAKALFDGQLLDVYFTRSFYKHILGVKVTY-HDIEAVDPDYYKNLKWL--LENDVSDILDLTFSMDADEEKHILYEKTEVTDYELKPGGRNIRVTEETKHEYVDLVAGHILTNAIRPQINAFLEGFNELIPRELVSIFNDKELELLISGLPEIDFDDL-KANTEYTS-YTAGSPVIHWFWEVVKAFSKEDMARFLQFVTGTSKVPLEGFKALQGISGPQRLQIHKAYGAPERLPSAHTCFNQLDLP 3655          
The following BLAST results are available for this feature:
BLAST of FC929031 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 73
Match NameE-valueIdentityDescription
UPL6_ARATH1.212e-13784.53E3 ubiquitin-protein ligase UPL6 OS=Arabidopsis th... [more]
UBE3C_HUMAN2.581e-6345.52Ubiquitin-protein ligase E3C OS=Homo sapiens GN=UB... [more]
UBE3C_MOUSE5.749e-6345.52Ubiquitin-protein ligase E3C OS=Mus musculus GN=Ub... [more]
YFK7_SCHPO8.301e-6243.32Probable E3 ubiquitin protein ligase C167.07c OS=S... [more]
UPL7_ARATH3.488e-6042.11E3 ubiquitin-protein ligase UPL7 OS=Arabidopsis th... [more]
UBE3B_XENTR2.500e-5842.72Ubiquitin-protein ligase E3B OS=Xenopus tropicalis... [more]
UBE3B_HUMAN5.568e-5842.05Ubiquitin-protein ligase E3B OS=Homo sapiens GN=UB... [more]
UBE3B_MOUSE2.116e-5741.72Ubiquitin-protein ligase E3B OS=Mus musculus GN=Ub... [more]
NEDD4_DROME3.070e-4036.27E3 ubiquitin-protein ligase Nedd-4 OS=Drosophila m... [more]
UPL1_ARATH5.418e-3737.59E3 ubiquitin-protein ligase UPL1 OS=Arabidopsis th... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAH1DC01RM2 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH1DC01, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929031 ID=FC929031|Name=FC929031|organism=Citrus clementina|type=EST|length=835bp
AGCATTTGATGTTCAGTATGGGTTATTCAAGGAAACATCTGATCACTTGC
TCTACCCTAATCCTGGATCTGGAATGATACATGAGCAGCATCTCCAGTTT
TTTCATTTTCTTGGAATTCTACTTGCAAAGGCCATGTTTGAAGGAATTCT
TGTTGATATCCCATTTGCAACATTCTTCTTGAGCAAGTTAAAACGGAAGT
ACAATTATTTGAATGACTTGCCCTCGTTAGATCCTGAATTATATCGTCAC
CTTATTTTCTTGAAGCATTATGAAGCTGACATTTCGGAGTTAGAACTCTA
CTTTGTTATTCTGAACAATGAATATGGAGAGCAAACAGAAGAGGAGCTGC
TTCCAGGAGGGAAGAACATACGTGTTACTAATGAGAATGTTATCACATTT
ATTCATCTTGTGTCCAATCACCGGCTGAATTTTCAGATACGTCAACAAAG
CTCTCATTTCCTGAGAGGCTTTCAGCAGCTTATACAGAAAGATTGGATCA
ATATGTTTAATGAGCATGAACTACAGCTGCTAATATCAGGTTCACTCGAT
AGCTTGGATTTTGATGACCTGAGACAGAACACTAACTATGTGGGAGGTTA
TCATAGTGAGCATTATGTTATTGAGATGTTCTGGGAAGTCCTCAAAAGCT
TTTCACTGGAAAACCAAAAGAAATTTTTGAAGTTTGTGACTGGGTGCTCT
CGAGGACCACTACTGGGATTCAAATATCTCGAGCCTTTATTCTGCATACA
AAGAGCTGCTGGTAGTGCTTCTGAAGAAGCTCTTGATCGGTTACCGACAT
CGGCTACTTGCATGAATCTTCTTAAGCTTCCACCA
back to top