FC929034

Overview
NameFC929034
Unique NameFC929034
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length875
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15009 contig Ccv1_Contig15009:1..875. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929034 vs. ExPASy Swiss-Prot
Match: TT12_ARATH (Protein TRANSPARENT TESTA 12 OS=Arabidopsis thaliana GN=TT12 PE=2 SV=1)

HSP 1 Score: 202.601 bits (514), Expect = 2.422e-51
Identity = 100/210 (47.62%), Postives = 138/210 (65.71%), Query Frame = -3
Query:  175 LGMGSAVETLCGQAYGANKYEMLGIYLQRSAVLLTLTGILMTVLYVFSRPILIFLGESPDIASSAAVFVYGLIPQIFAYALNFPIQKFLQAQSIVAPSAYISTATLVVHLLLSWVAVYEXXXXXXXXXXXXXXSWWIVVIAQFVYIVKSDRCKHTWRGFTVQAFSGLPSFFKLSAASAVMLCLETWYFQILVLLAGLLPNPELALDSLSI 804
            LGM SAV+T+CGQAYGA +Y  +GI  QR+ VL     + +T LY +S PIL  +G+S  IA    +F  G+IPQI+A+AL  P+Q+FLQAQ+IV P AY+S    ++H LL+W+                  SWW++V    +YI+ S  CK TW GF+ +AF G+  +FKL+ ASAVMLCLE WY Q LV+++GLL NP ++LD++SI
Sbjct:  107 LGMASAVQTVCGQAYGARQYSSMGIICQRAMVLHLAAAVFLTFLYWYSGPILKTMGQSVAIAHEGQIFARGMIPQIYAFALACPMQRFLQAQNIVNPLAYMSLGVFLLHTLLTWLVTNVLDFGLLGAALILSFSWWLLVAVNGMYILMSPNCKETWTGFSTRAFRGIWPYFKLTVASAVMLCLEIWYNQGLVIISGLLSNPTISLDAISI 316          
BLAST of FC929034 vs. ExPASy Swiss-Prot
Match: S47A1_RABIT (Multidrug and toxin extrusion protein 1 OS=Oryctolagus cuniculus GN=SLC47A1 PE=2 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 3.772e-20
Identity = 58/208 (27.88%), Postives = 107/208 (51.44%), Query Frame = -3
Query:  178 GMGSAVETLCGQAYGANKYEMLGIYLQRSAVLLTLTGILMTVLYVFSRPILIFLGESPDIASSAAVFVYGLIPQIFAYALNFPIQKFLQAQSIVAPSAYISTATLVVHLLLSWVAVYEXXXXXXXXXXXXXXSWWIVVIAQFVYIVKSDRCKHTWRGFTVQAFSGLPSFFKLSAASAVMLCLETWYFQILVLLAGLLPNPELALDSLS 801
            G+ SA +TL  Q YG+   + +G+ LQR +++L L  +    L++ ++ IL+   + P ++     +V   IP + A  L     K+L  Q IV P      A  +V+ L +++ VY+              + + + +  F+YI++S   + TW G++++      SFF+L+  S +MLC+E W ++I   L+G+L   EL   S++
Sbjct:   90 GLSSACDTLISQTYGSRNLKHVGVILQRGSLILLLCCLPCWALFLNTQHILLLFRQDPAVSRLTQTYVTIFIPALPATFLYTLQVKYLLNQGIVLPQVVTGVAANLVNALANYLFVYQLHLGVMGSALANTVAQFTLALLLFLYILRSKVYQATWGGWSLECLQDWASFFRLAIPSMLMLCMEWWAYEIGSFLSGILGMVELGAQSVT 297          
BLAST of FC929034 vs. ExPASy Swiss-Prot
Match: YAO6_SCHPO (Uncharacterized transporter C11D3.06 OS=Schizosaccharomyces pombe GN=SPAC11D3.06 PE=2 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 4.927e-20
Identity = 63/210 (30.00%), Postives = 108/210 (51.43%), Query Frame = -3
Query:  181 LGMGSAVETLCGQAYGANKYEMLGIYLQRSAVLLTLTGILMTVLYVFSRPILIFLGESPDIASSAAVFVYGLIPQIFAYALNFPIQKFLQAQSIVAPSAYISTATLVVHLLLSWVAVYEXXXXXXXXXXXXXXSWWI--VVIAQFVYIVKSDRCKHTWRGFTVQAFSGLPSFFKLSAASAVMLCLETWYFQILVLLAGLLPNPELALDSL 804
            LG  +A +TL    +GA K + LGI LQ   ++L++  + + +++ +S+PILIFL ++P++A ++  F+  LIP    Y     ++KFLQ Q I    +YI   T  +++ L+++ V+               S+W+  +++ Q+   VK       W G+  +       F KLS    VM+  E W F+I+ L+AG L    LA  S+
Sbjct:   63 LGGTTAFDTLGSNLWGAGKKQELGILLQTGFIVLSILYLPICLVWWYSKPILIFLHQTPELAEASQKFLRYLIPGGLGYVCFELLKKFLQTQEITRAGSYILLVTSPLNVALNFLLVHYYGLGLKGAPLATGLSYWLSFILLTQYAKYVKG---AEAWNGWNKRCLENFGPFVKLSLLGIVMVGTEWWAFEIVALVAGKLGAVPLAAQSV 269          
BLAST of FC929034 vs. ExPASy Swiss-Prot
Match: S47A1_XENTR (Multidrug and toxin extrusion protein 1 OS=Xenopus tropicalis GN=slc47a1 PE=2 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 1.872e-19
Identity = 57/207 (27.54%), Postives = 102/207 (49.28%), Query Frame = -3
Query:  181 GMGSAVETLCGQAYGANKYEMLGIYLQRSAVLLTLTGILMTVLYVFSRPILIFLGESPDIASSAAVFVYGLIPQIFAYALNFPIQKFLQAQSIVAPSAYISTATLVVHLLLSWVAVYEXXXXXXXXXXXXXXSWWIVVIAQFVYIVKSDRCKHTWRGFTVQAFSGLPSFFKLSAASAVMLCLETWYFQILVLLAGLLPNPELALDSL 801
            G+  A +TL  Q +G +  +++GI LQR  ++L L       L + +  IL+   + P+++    ++V   +P + A  L   + K+LQ Q I+ P         + + L +++ +Y               S +I +I  F+YIV       TW G++   F    +F +L+ AS +MLC+E W F+I + LAG+L   +LA  ++
Sbjct:  105 GLAGACDTLISQTFGGSNLKLVGIILQRGILILLLFCFPCWALLINTESILLLFRQDPEVSKLTQIYVLIFLPALPAAFLYQLLAKYLQNQGIIYPQVLTGFIANIFNALFNYILLYVLGLGVMGSACANTVSQFIQMILLFLYIVWRRLYADTWGGWSQACFEEWGAFIRLAVASMLMLCIEWWAFEISMFLAGVLGMVDLAAQAI 311          
BLAST of FC929034 vs. ExPASy Swiss-Prot
Match: S47A1_HUMAN (Multidrug and toxin extrusion protein 1 OS=Homo sapiens GN=SLC47A1 PE=1 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 4.171e-19
Identity = 57/207 (27.54%), Postives = 104/207 (50.24%), Query Frame = -3
Query:  181 GMGSAVETLCGQAYGANKYEMLGIYLQRSAVLLTLTGILMTVLYVFSRPILIFLGESPDIASSAAVFVYGLIPQIFAYALNFPIQKFLQAQSIVAPSAYISTATLVVHLLLSWVAVYEXXXXXXXXXXXXXXSWWIVVIAQFVYIVKSDRCKHTWRGFTVQAFSGLPSFFKLSAASAVMLCLETWYFQILVLLAGLLPNPELALDSL 801
            G+ SA +TL  Q YG+   + +G+ LQRSA++L L       L++ ++ IL+   + PD++     +V   IP + A  L     K+L  Q IV P      A  +V+ L +++ +++              S + + +  F+YI+     + TW G++++      SF +L+  S +MLC+E W +++   L+G+L   EL   S+
Sbjct:   91 GLSSACDTLISQTYGSQNLKHVGVILQRSALVLLLCCFPCWALFLNTQHILLLFRQDPDVSRLTQTYVTIFIPALPATFLYMLQVKYLLNQGIVLPQIVTGVAANLVNALANYLFLHQLHLGVIGSALANLISQYTLALLLFLYILGKKLHQATWGGWSLECLQDWASFLRLAIPSMLMLCMEWWAYEVGSFLSGILGMVELGAQSI 297          
BLAST of FC929034 vs. ExPASy Swiss-Prot
Match: S47A1_DANRE (Multidrug and toxin extrusion protein 1 OS=Danio rerio GN=slc47a1 PE=2 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 7.114e-19
Identity = 59/208 (28.37%), Postives = 109/208 (52.40%), Query Frame = -3
Query:  181 GMGSAVETLCGQAYGANKYEMLGIYLQRSAVLLTLTGILMTVLYVFSRPILIFLGESPDIASSAAVFVYGLIPQIFAYALNFPIQ-KFLQAQSIVAPSAYISTATLVVHLLLSWVAVYEXXXXXXXXXXXXXXSWWIVVIAQFVYIVKSDRCKHTWRGFTVQAFSGLPSFFKLSAASAVMLCLETWYFQILVLLAGLLPNPELALDSL 801
            G+ SA +TL  Q +G+N  + +G+ LQR  ++L L       L + + PIL+ + +SP++AS + ++V   +P + A A  + +Q ++LQ Q I+ P      A  +++ L+++V ++               S + + +  +VYI   +  K TW G++        +F +L+  S +MLC+E W ++I   LAGL+   EL   S+
Sbjct:  109 GLASACDTLISQTFGSNNLKRVGVILQRGILILLLACFPCWALLINTEPILLAVRQSPNVASLSQLYVKIFMPALPA-AFMYQLQGRYLQNQGIIWPQVITGAAGNILNALINYVFLHLLELGVAGSAAANTISQYSLAVFLYVYIRWKNLHKATWDGWSRDCLQEWGAFIRLALPSMLMLCVEWWTYEIGGFLAGLISETELGAQSV 315          
BLAST of FC929034 vs. ExPASy Swiss-Prot
Match: S47A1_PONAB (Multidrug and toxin extrusion protein 1 OS=Pongo abelii GN=SLC47A1 PE=2 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 9.291e-19
Identity = 57/207 (27.54%), Postives = 102/207 (49.28%), Query Frame = -3
Query:  181 GMGSAVETLCGQAYGANKYEMLGIYLQRSAVLLTLTGILMTVLYVFSRPILIFLGESPDIASSAAVFVYGLIPQIFAYALNFPIQKFLQAQSIVAPSAYISTATLVVHLLLSWVAVYEXXXXXXXXXXXXXXSWWIVVIAQFVYIVKSDRCKHTWRGFTVQAFSGLPSFFKLSAASAVMLCLETWYFQILVLLAGLLPNPELALDSL 801
            G+ SA +TL  Q YG+   + +G+ LQRSA++L L       L++ ++ IL+   + PD++     +V   IP + A  L     K+L  Q IV P      A  +V+ L +++ +++              S + + +  F YI+     + TW G++++      SF  L+  S +MLC+E W +++   L+G+L   EL   S+
Sbjct:   91 GLSSACDTLISQTYGSQNLKHVGVILQRSALILLLCCFPCWALFLNTQHILLLFRQDPDVSRLTQTYVTIFIPALPATFLYMLQVKYLLNQGIVLPQIVTGVAANLVNALANYLFLHQLHLGAIGSALANLISQYTLALLLFFYILGKKLHQATWGGWSLECLQDWASFLHLAVPSMLMLCMEWWAYEVGSFLSGILGMVELGAQSI 297          
BLAST of FC929034 vs. ExPASy Swiss-Prot
Match: S47A2_MOUSE (Multidrug and toxin extrusion protein 2 OS=Mus musculus GN=Slc47a2 PE=1 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 1.213e-18
Identity = 60/208 (28.85%), Postives = 105/208 (50.48%), Query Frame = -3
Query:  181 GMGSAVETLCGQAYGANKYEMLGIYLQRSAVLLTLTGILMTVLYVFSRPILIFLGESPDIASSAAVFVYGLIPQIFAYALNFPIQ-KFLQAQSIVAPSAYISTATLVVHLLLSWVAVYEXXXXXXXXXXXXXXSWWIVVIAQFVYIVKSDRCKHTWRGFTVQAFSGLPSFFKLSAASAVMLCLETWYFQILVLLAGLLPNPELALDSL 801
            G+ SA +TL  Q++G    + +G+ LQR  ++L L       +++ +  +L+ L + PD+A  A V+V   IP + A A  F +Q ++LQ+Q I+ P   +  A  VV++ ++   +Y               S + +    F+Y+       HTW G+T + F    S+ +L+  S  M+C+E W F+I   LAGL+   EL   ++
Sbjct:  100 GLASACDTLMSQSFGGKNLKRVGVILQRGILILLLCCFPCWAIFLNTERLLLLLRQDPDVARLAQVYVMICIPALPA-AFLFQLQTRYLQSQGIIMPQVIVGIAANVVNVGMNAFLLYALDLGVVGSAWANTTSQFFLSALLFLYVWWKRIHIHTWGGWTRECFQEWSSYTRLAIPSMFMVCIEWWTFEIGTFLAGLVNVTELGAQAV 306          
BLAST of FC929034 vs. ExPASy Swiss-Prot
Match: S47A1_MOUSE (Multidrug and toxin extrusion protein 1 OS=Mus musculus GN=Slc47a1 PE=1 SV=2)

HSP 1 Score: 92.8189 bits (229), Expect = 2.703e-18
Identity = 58/208 (27.88%), Postives = 100/208 (48.08%), Query Frame = -3
Query:  178 GMGSAVETLCGQAYGANKYEMLGIYLQRSAVLLTLTGILMTVLYVFSRPILIFLGESPDIASSAAVFVYGLIPQIFAYALNFPIQKFLQAQSIVAPSAYISTATLVVHLLLSWVAVYEXXXXXXXXXXXXXXSWWIVVIAQFVYIVKSDRCKHTWRGFTVQAFSGLPSFFKLSAASAVMLCLETWYFQILVLLAGLLPNPELALDSLS 801
            G+ SA +TL  Q YG+   + +G+ LQR  ++L L       L++ +  IL+   + PD++     +V   IP + A  L     K+L  Q IV P      A  +V+ L ++V +Y               S + + I  F+YI+     + TW G++ +      SF +L+  S +MLC+E W +++   L+G+L   EL   S++
Sbjct:   91 GLSSACDTLISQTYGSQNLKHVGVILQRGTLILLLCCFPCWALFINTEQILLLFRQDPDVSRLTQTYVMIFIPALPAAFLYTLQVKYLLNQGIVLPQIMTGIAANLVNALANYVFLYHLHLGVMGSALANTISQFALAIFLFLYILWRRLHQATWGGWSWECLQDWASFLRLAIPSMLMLCIEWWAYEVGSFLSGILGMVELGAQSIT 298          
BLAST of FC929034 vs. ExPASy Swiss-Prot
Match: S47A1_RAT (Multidrug and toxin extrusion protein 1 OS=Rattus norvegicus GN=Slc47a1 PE=1 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 1.342e-17
Identity = 56/208 (26.92%), Postives = 100/208 (48.08%), Query Frame = -3
Query:  178 GMGSAVETLCGQAYGANKYEMLGIYLQRSAVLLTLTGILMTVLYVFSRPILIFLGESPDIASSAAVFVYGLIPQIFAYALNFPIQKFLQAQSIVAPSAYISTATLVVHLLLSWVAVYEXXXXXXXXXXXXXXSWWIVVIAQFVYIVKSDRCKHTWRGFTVQAFSGLPSFFKLSAASAVMLCLETWYFQILVLLAGLLPNPELALDSLS 801
            G+ SA +TL  Q YG+   + +G+ LQR  ++L L       L++ +  IL+   + PD++     +V   IP + A  L     K+L  Q IV P      A  +V+ L +++ +++              S + + I  F+YI+       TW G++ +      SF +L+  S +MLC+E W +++   L+G+L   EL   S++
Sbjct:   90 GLSSACDTLISQTYGSQNLKHVGVILQRGTLILLLCCFPCWALFINTEQILLLFRQDPDVSRLTQTYVMVFIPALPAAFLYTLQVKYLLNQGIVLPQVITGIAANLVNALANYLFLHQLHLGVMGSALANTISQFALAIFLFLYILWRKLHHATWGGWSWECLQDWASFLQLAIPSMLMLCIEWWAYEVGSFLSGILGMVELGAQSIT 297          
The following BLAST results are available for this feature:
BLAST of FC929034 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 15
Match NameE-valueIdentityDescription
TT12_ARATH2.422e-5147.62Protein TRANSPARENT TESTA 12 OS=Arabidopsis thalia... [more]
S47A1_RABIT3.772e-2027.88Multidrug and toxin extrusion protein 1 OS=Oryctol... [more]
YAO6_SCHPO4.927e-2030.00Uncharacterized transporter C11D3.06 OS=Schizosacc... [more]
S47A1_XENTR1.872e-1927.54Multidrug and toxin extrusion protein 1 OS=Xenopus... [more]
S47A1_HUMAN4.171e-1927.54Multidrug and toxin extrusion protein 1 OS=Homo sa... [more]
S47A1_DANRE7.114e-1928.37Multidrug and toxin extrusion protein 1 OS=Danio r... [more]
S47A1_PONAB9.291e-1927.54Multidrug and toxin extrusion protein 1 OS=Pongo a... [more]
S47A2_MOUSE1.213e-1828.85Multidrug and toxin extrusion protein 2 OS=Mus mus... [more]
S47A1_MOUSE2.703e-1827.88Multidrug and toxin extrusion protein 1 OS=Mus mus... [more]
S47A1_RAT1.342e-1726.92Multidrug and toxin extrusion protein 1 OS=Rattus ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAH1DC04RM2 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH1DC04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929034 ID=FC929034|Name=FC929034|organism=Citrus clementina|type=EST|length=875bp
GGAAAATTACCCATTTGAACAATCAAATGTAGCAAATGATGGCTTTGGCA
ACCAAATGAAATCATGAGTGATTTGTGAAACTAATTTACTGAAAGTTAAG
GGGGGAGAGCTTAGATGCAATTATCAGAAAAGGGCGTGACCAAAAAGGGA
AGGAAAATAGTTTTCTGCTTACCAAATGGAAAGAGAGTCCAAAGCCAACT
CCGGATTTGGTAACAAACCAGCCAATAGAACAAGAATCTGAAAGTACCAC
GTCTCCAAGCACAGCATCACAGCGGAGGCAGCCGATAGTTTGAAGAAGGA
AGGGAGACCAGAGAAGGCCTGAACAGTAAACCCACGCCACGTGTGCTTAC
ACCTATCACTTTTAACAATATAAACAAACTGAGCAATCACAACAATCCAC
CAGGATAAGCTCAAGATCAGTGAGGCGCCAATCAAGCCAAGCCCGATTTC
GTAGACTGCAACCCAACTTAGCAGCAGATGCACCACTAACGTGGCCGTTG
AAATGTATGCACTTGGAGCCACTATGCTTTGTGCTTGCAAAAATTTTTGG
ATTGGGAAGTTCAAGGCGTATGCAAAGATTTGGGGTATCAGGCCGTAGAC
AAAAACTGCCGCTGATGAGGCAATATCTGGCGACTCCCCTAGAAAAATCA
AAATTGGTCTCGAAAAGACGTATAGAACTGTCATTAAAATCCCCGTGAGC
GTCAGCAGAACCGCTGATCTTTGCAAATATATCCCTAGCATTTCATATTT
GTTTGCACCGTATGCTTGCCCACATAATGTCTCCACGGCACTTCCCATTC
CCAACTGTTAACAAAAGAATTTAATTATAAGAATATTAAAGTACCCTGTG
TGCGTGTGCGTATGTACTTACGTAC
back to top