FC929036

Overview
NameFC929036
Unique NameFC929036
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length732
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of FC929036 vs. ExPASy Swiss-Prot
Match: PPA1_SOLLC (Acid phosphatase 1 OS=Solanum lycopersicum GN=APS1 PE=2 SV=1)

HSP 1 Score: 155.221 bits (391), Expect = 3.297e-37
Identity = 71/159 (44.65%), Postives = 102/159 (64.15%), Query Frame = 3
Query:  249 LSCLSWRLGVETNNVIGWATVPEKCADYVGHYMLGQQYRLDSEVVANEAILHAQSLTLAGDGKDIWVFDIDETSLCNLPYYAKNGFGVKPYNPTMFNEWVNTGKAXXXXXXXXXXXXXXXXGIKIVFLTGRPEDQRNVTEANLKHAGFNTWEKLILXGS 725
            L C +WR  VETNN+  W T+PE+CADYV  YM+G  Y+++ + V++EA  +A+S+ L  DG+D+W+FD+DET L NLPYY+ + +G++ ++   F++WV  G A                G K+  LTGR E  R+VT  NL +AGF+ W KLIL GS
Sbjct:   41 LKCTTWRFVVETNNLSPWKTIPEECADYVKEYMVGPGYKMEIDRVSDEAGEYAKSVDLGDDGRDVWIFDVDETLLSNLPYYSDHRYGLEVFDDVEFDKWVENGTAPALGSSLKLYQEVLKLGFKVFLLTGRSERHRSVTVENLMNAGFHDWHKLILRGS 199          
BLAST of FC929036 vs. ExPASy Swiss-Prot
Match: VSPA_SOYBN (Stem 28 kDa glycoprotein OS=Glycine max GN=VSPA PE=2 SV=1)

HSP 1 Score: 152.525 bits (384), Expect = 2.137e-36
Identity = 73/158 (46.20%), Postives = 102/158 (64.56%), Query Frame = 3
Query:  243 PGLSCLSWRLGVETNNVIGWATVPEKCADYVGHYMLGQQYRLDSEVVANEAILHAQSLTLAGDGKDIWVFDIDETSLCNLPYYAKNGFGVKPYNPTMFNEWVNTGKAXXXXXXXXXXXXXXXXGIKIVFLTGRPEDQRNVTEANLKHAGFNTWEKLIL 716
            P + C SWRL VE +N+ G+ T+PE+C +    Y+ G+QYR DS+ V  +A  +A+ L +    KD +VF ID T L N+PYY K+G+GV+ +N T+++EWVN G A                G KI+FL+GR  D++ VTEANLK AG++TWEKLIL
Sbjct:   38 PEVKCASWRLAVEAHNIFGFETIPEECVEATKEYIHGEQYRSDSKTVNQQAYFYARDLEV--HPKDTFVFSIDGTVLSNIPYYKKHGYGVEKFNSTLYDEWVNKGNAPALPETLKNYNKLVSLGFKIIFLSGRTLDKQAVTEANLKKAGYHTWEKLIL 193          
BLAST of FC929036 vs. ExPASy Swiss-Prot
Match: S25K_SOYBN (Stem 31 kDa glycoprotein (Fragment) OS=Glycine max GN=VSP25 PE=2 SV=2)

HSP 1 Score: 152.525 bits (384), Expect = 2.137e-36
Identity = 73/158 (46.20%), Postives = 102/158 (64.56%), Query Frame = 3
Query:  243 PGLSCLSWRLGVETNNVIGWATVPEKCADYVGHYMLGQQYRLDSEVVANEAILHAQSLTLAGDGKDIWVFDIDETSLCNLPYYAKNGFGVKPYNPTMFNEWVNTGKAXXXXXXXXXXXXXXXXGIKIVFLTGRPEDQRNVTEANLKHAGFNTWEKLIL 716
            P + C SWRL VE +N+ G+ T+PE+C +    Y+ G+QYR DS+ V  +A  +A+ L +    KD +VF ID T L N+PYY K+G+GV+ +N T+++EWVN G A                G KI+FL+GR  D++ VTEANLK AG++TWEKLIL
Sbjct:   35 PEVKCASWRLAVEAHNIFGFETIPEECVEATKEYIHGEQYRSDSKTVNQQAYFYARDLEV--HPKDTFVFSIDGTVLSNIPYYKKHGYGVEKFNSTLYDEWVNKGNAPALPETLKNYNKLVSLGFKIIFLSGRTLDKQAVTEANLKKAGYHTWEKLIL 190          
BLAST of FC929036 vs. ExPASy Swiss-Prot
Match: VSPB_SOYBN (Stem 31 kDa glycoprotein OS=Glycine max GN=VSPB PE=2 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 4.171e-32
Identity = 71/165 (43.03%), Postives = 103/165 (62.42%), Query Frame = 3
Query:  222 GSRNNDVPGLSCLSWRLGVETNNVIGWATVPEKCADYVGHYMLGQQYRLDSEVVANEAILHAQSLTLAGDGKDIWVFDIDETSLCNLPYYAKNGFGVKPYNPTMFNEWVNTGKAXXXXXXXXXXXXXXXXGIKIVFLTGRPEDQRNVTEANLKHAGFNTWEKLIL 716
            G R+++V    C S+RL VE +N+  + T+PE+C +    Y+ G+Q+R DS+ V  +A  +A    +  +  DI++F ID T L N+PYY K+G+GV+ +N T+++EWVN G A                G KIVFL+GR  D+  VTEANLK AGF+TWE+LIL
Sbjct:   35 GERSSEV---KCASFRLAVEAHNIRAFKTIPEECVEPTKDYINGEQFRSDSKTVNQQAFFYASEREVHHN--DIFIFGIDNTVLSNIPYYEKHGYGVEEFNETLYDEWVNKGDAPALPETLKNYNKLLSLGFKIVFLSGRYLDKMAVTEANLKKAGFHTWEQLIL 194          
BLAST of FC929036 vs. ExPASy Swiss-Prot
Match: VSP2_ARATH (Vegetative storage protein 2 OS=Arabidopsis thaliana GN=VSP2 PE=1 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 4.467e-26
Identity = 61/157 (38.85%), Postives = 91/157 (57.96%), Query Frame = 3
Query:  252 SCLSWRLGVETNNVIGWATVPEKCADYVGHYML-GQQYRLDSEVVANEAILHAQSLTLAGDGKDIWVFDIDETSLCNLPYYAKNGFGVKPYNPTMFNEWVNTG-KAXXXXXXXXXXXXXXXXGIKIVFLTGRPEDQRNVTEANLKHAGFNTWEKLIL 716
            +C SW LGVET+N+I + TVP  C DYV  Y++  +QY+ DS+ V  EA  +A+ L L  D  ++W+FD+D+T L ++PYYAK G+G +  +P  +  W+ TG                   GI+ + L+ R +  +NVT  NL+ AG   W+ LIL
Sbjct:   51 NCRSWHLGVETSNIIDFDTVPANCKDYVEDYLITSKQYQYDSKTVCKEAYFYAKGLALKNDTVNVWIFDLDDTLLSSIPYYAKYGYGTEKTDPGAYWLWLGTGASTPGLPEALHLYQNIIELGIEPIILSDRWKLWKNVTLDNLEAAGVTYWKHLIL 207          
BLAST of FC929036 vs. ExPASy Swiss-Prot
Match: VSP1_ARATH (Vegetative storage protein 1 OS=Arabidopsis thaliana GN=VSP1 PE=2 SV=2)

HSP 1 Score: 111.694 bits (278), Expect = 4.181e-24
Identity = 57/157 (36.31%), Postives = 88/157 (56.05%), Query Frame = 3
Query:  252 SCLSWRLGVETNNVIGWATVPEKCADYVGHYML-GQQYRLDSEVVANEAILHAQSLTLAGDGKDIWVFDIDETSLCNLPYYAKNGFGVKPYNPTMFNEWVNTGKA-XXXXXXXXXXXXXXXXGIKIVFLTGRPEDQRNVTEANLKHAGFNTWEKLIL 716
            +C SW LGVET+N+I + TVP  C  YV  Y++  +QY+ DS+ V  EA  +A+ L L  D  ++W+FD+D+T L ++PYYAK G+G +   P  +  W+ +G++                 GI+ + ++ R +    VT  NLK  G   W+ LIL
Sbjct:   56 NCRSWHLGVETSNIINFDTVPANCKAYVEDYLITSKQYQYDSKTVNKEAYFYAKGLALKNDTVNVWIFDLDDTLLSSIPYYAKYGYGTENTAPGAYWSWLESGESTPGLPETLHLYENLLELGIEPIIISDRWKKLSEVTVENLKAVGVTKWKHLIL 212          
The following BLAST results are available for this feature:
BLAST of FC929036 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 6
Match NameE-valueIdentityDescription
PPA1_SOLLC3.297e-3744.65Acid phosphatase 1 OS=Solanum lycopersicum GN=APS1... [more]
VSPA_SOYBN2.137e-3646.20Stem 28 kDa glycoprotein OS=Glycine max GN=VSPA PE... [more]
S25K_SOYBN2.137e-3646.20Stem 31 kDa glycoprotein (Fragment) OS=Glycine max... [more]
VSPB_SOYBN4.171e-3243.03Stem 31 kDa glycoprotein OS=Glycine max GN=VSPB PE... [more]
VSP2_ARATH4.467e-2638.85Vegetative storage protein 2 OS=Arabidopsis thalia... [more]
VSP1_ARATH4.181e-2436.31Vegetative storage protein 1 OS=Arabidopsis thalia... [more]
back to top
Properties
Property NameValue
Genbank descriptionKN0AAH1DC06RM2 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH1DC06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929036 ID=FC929036; Name=FC929036; organism=Citrus clementina; type=EST; length=732bp
GGCACGAGGTTTTTATCGTGAGGAAAAACAATATTACAGTTGTAATGAGC
ATGGGAGGGGTGTCACTGCCATTATTATTCTTTTTTCTGGCTACCATATC
AGCAACATCCCATGGATTTAGCATGGACATCCGCCATCTTTTTCTGGCTA
CCATACCAGCAACATCCCATGGATTTAGCATGGACATCCCCCATCAGATT
CATCTTCTCCGACCGAAAGCCGGTTCCCGGAACAACGATGTGCCCGGCTT
GTCCTGCCTGAGTTGGCGACTCGGAGTGGAAACTAATAACGTTATAGGAT
GGGCGACTGTTCCCGAAAAATGTGCAGACTACGTGGGGCATTACATGTTA
GGCCAGCAGTACCGCCTGGACTCTGAAGTGGTTGCTAATGAGGCCATTCT
CCATGCTCAGAGCCTCACGCTTGCTGGCGACGGCAAGGACATTTGGGTTT
TCGACATAGATGAAACCTCGCTATGTAATTTGCCATATTATGCTAAGAAT
GGATTCGGGGTGAAGCCGTACAACCCTACTATGTTTAATGAATGGGTTAA
CACCGGAAAAGCACCACCGCTGCCAGAGAGCCTTAAGCTTTACAAAAAAT
TATTATTGCTTGGAATTAAGATTGTATTCCTCACGGGAAGACCAGAAGAT
CAGAGAAATGTTACAGAAGCTAATTTAAAGCATGCTGGATTCAACACTTG
GGAGAAGCTCATCCTCAANGGATCATCTCATT
back to top