FC929062

Overview
NameFC929062
Unique NameFC929062
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length826
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig6173 contig Ccv1_Contig6173:36..861. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929062 vs. ExPASy Swiss-Prot
Match: ALF_MAIZE (Fructose-bisphosphate aldolase, cytoplasmic isozyme OS=Zea mays PE=2 SV=1)

HSP 1 Score: 443.351 bits (1139), Expect = 7.487e-124
Identity = 221/255 (86.67%), Postives = 235/255 (92.16%), Query Frame = 1
Query:   61 MSCFKGKYADELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCTPGALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPIVEPEILVDGPHDIKKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSEAPKVTPDVIAEHTVRALQRTM 825
            MS + GKY DELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVE NRRALRELLFC PGALQY+SGVILFEETLYQKT  GKPFVDVLKEGGVLPGIKVDKGT+E+ GT+ ETTTQG D L +RC KYYEAGARFAKWRAVLKIGPNEPSQLAI+ NA GLARYAIICQENGLVPIVEPEILVDGPHDI +CA VTE VLAACYKALN+HHVLLEGTLLKPNMVTPGS++ KVTP+VIAE+TVR LQRT+
Sbjct:    1 MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVEENRRALRELLFCCPGALQYISGVILFEETLYQKTKDGKPFVDVLKEGGVLPGIKVDKGTIEVVGTDKETTTQGHDDLGKRCAKYYEAGARFAKWRAVLKIGPNEPSQLAIDLNAQGLARYAIICQENGLVPIVEPEILVDGPHDIDRCAYVTETVLAACYKALNEHHVLLEGTLLKPNMVTPGSDSKKVTPEVIAEYTVRTLQRTV 255          
BLAST of FC929062 vs. ExPASy Swiss-Prot
Match: ALF_ORYSJ (Fructose-bisphosphate aldolase cytoplasmic isozyme OS=Oryza sativa subsp. japonica GN=FBA PE=1 SV=2)

HSP 1 Score: 441.039 bits (1133), Expect = 3.716e-123
Identity = 220/255 (86.27%), Postives = 235/255 (92.16%), Query Frame = 1
Query:   61 MSCFKGKYADELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCTPGALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPIVEPEILVDGPHDIKKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSEAPKVTPDVIAEHTVRALQRTM 825
            MS + GKY DELIKNAAYIGTPGKGILAADESTGTIGKR +SINVENVE NRR+LRELLFCTPGALQYLSGVILFEETLYQKT  GKPFVDVLKEGGVLPGIKVDKGT+E+AGT  ETTTQG D L +RC KYYEAGARFAKWRAVLKIGPNEPSQLAI+ NA GLARYAIICQENGLVPIVEPEILVDGPHDI +CA V+E VLAACYKALN+HHVLLEGTLLKPNMVTPGS+A KV+P+VIAE+TVR LQRT+
Sbjct:    1 MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIGKRFASINVENVEENRRSLRELLFCTPGALQYLSGVILFEETLYQKTKDGKPFVDVLKEGGVLPGIKVDKGTIEVAGTEKETTTQGHDDLGKRCAKYYEAGARFAKWRAVLKIGPNEPSQLAIDLNAQGLARYAIICQENGLVPIVEPEILVDGPHDIDRCAYVSEVVLAACYKALNEHHVLLEGTLLKPNMVTPGSDAKKVSPEVIAEYTVRTLQRTV 255          
BLAST of FC929062 vs. ExPASy Swiss-Prot
Match: ALF_SPIOL (Fructose-bisphosphate aldolase, cytoplasmic isozyme OS=Spinacia oleracea PE=2 SV=1)

HSP 1 Score: 439.113 bits (1128), Expect = 1.412e-122
Identity = 219/255 (85.88%), Postives = 234/255 (91.76%), Query Frame = 1
Query:   61 MSCFKGKYADELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCTPGALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPIVEPEILVDGPHDIKKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSEAPKVTPDVIAEHTVRALQRTM 825
            M+ ++GKYADELI NA+YI TPGK ILAADESTGTIGKR  SINVENVESNRRALRELLF TPGAL YLSGVILFEETLYQKTA GKPFVD +K+GGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRC +YY AGARFAKWRAVLKIGP EPS LAI ENANGLARY IICQENGLVPIVEPEILVDG HDI +CA+V+ERVLAACYKALNDHHVLLEGT LKPN+VTPGSE+ KVTP+VIAE+TVR LQRT+
Sbjct:    1 MTAYRGKYADELIANASYIATPGKVILAADESTGTIGKRFPSINVENVESNRRALRELLFTTPGALPYLSGVILFEETLYQKTADGKPFVDAMKDGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCAQYYTAGARFAKWRAVLKIGPTEPSPLAILENANGLARYGIICQENGLVPIVEPEILVDGTHDIDRCAEVSERVLAACYKALNDHHVLLEGTSLKPNIVTPGSESKKVTPEVIAEYTVRTLQRTV 255          
BLAST of FC929062 vs. ExPASy Swiss-Prot
Match: ALF2_PEA (Fructose-bisphosphate aldolase, cytoplasmic isozyme 2 OS=Pisum sativum PE=3 SV=1)

HSP 1 Score: 432.565 bits (1111), Expect = 1.322e-120
Identity = 221/256 (86.33%), Postives = 234/256 (91.41%), Query Frame = 1
Query:   61 MSCFKGKYADELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCTPGA-LQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPIVEPEILVDGPHDIKKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSEAPKVTPDVIAEHTVRALQRTM 825
            MS FK KY DELI NAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNR+ALRELLF      LQYLSGVILFEETLYQKTAAGKPFVDVL E GVLPGIKVDKGTVELAGT+GETTTQGLDGL  RC+KYYEAGARFAKWRAVLKIG NEPS+ +I+ENA GLARYA+ICQENGLVPIVEPEILVDG HDI KCA +TERVLAA YKAL+DHHV+LEGTLLKPNMVTPGS+APKV P+VIAEHTVRALQRT+
Sbjct:    1 MSHFKSKYHDELIANAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRQALRELLFTASWLFLQYLSGVILFEETLYQKTAAGKPFVDVLNEAGVLPGIKVDKGTVELAGTDGETTTQGLDGLGARCRKYYEAGARFAKWRAVLKIGANEPSEHSIHENAYGLARYAVICQENGLVPIVEPEILVDGSHDILKCAAITERVLAATYKALSDHHVILEGTLLKPNMVTPGSDAPKVAPEVIAEHTVRALQRTV 256          
BLAST of FC929062 vs. ExPASy Swiss-Prot
Match: ALF_CICAR (Fructose-bisphosphate aldolase, cytoplasmic isozyme OS=Cicer arietinum GN=ALDC PE=2 SV=1)

HSP 1 Score: 429.483 bits (1103), Expect = 1.119e-119
Identity = 218/256 (85.16%), Postives = 231/256 (90.23%), Query Frame = 1
Query:   61 MSCFKGKYADELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCTPGALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAIN-ENANGLARYAIICQENGLVPIVEPEILVDGPHDIKKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSEAPKVTPDVIAEHTVRALQRTM 825
            MS FK KY DELI NAAYIGTPGKGILAADESTGTIGKRL+SINVENVE+NRRALRELLF  P  LQYLSGVILFEETLYQ TAAGKPFVDVL E GVLPGIKVDKGTVELAGT+GETTTQGLDGL  RC KYYEAGARFAKWRAVLKIGPNEPS   ++ ENA GLARYA+ICQENGLVPIVE EILVDG HDI KCA +TERVLAA YKAL+DHHVLLEGTLLKPNMVTPGS++PKV P+V+AEHTVRALQRT+
Sbjct:    1 MSNFKSKYHDELIANAAYIGTPGKGILAADESTGTIGKRLASINVENVETNRRALRELLFTAPNVLQYLSGVILFEETLYQSTAAGKPFVDVLNEAGVLPGIKVDKGTVELAGTDGETTTQGLDGLGARCAKYYEAGARFAKWRAVLKIGPNEPSLSILSIENAYGLARYAVICQENGLVPIVELEILVDGSHDIHKCAAITERVLAATYKALSDHHVLLEGTLLKPNMVTPGSDSPKVAPEVVAEHTVRALQRTV 256          
BLAST of FC929062 vs. ExPASy Swiss-Prot
Match: ALF1_PEA (Fructose-bisphosphate aldolase, cytoplasmic isozyme 1 OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 417.542 bits (1072), Expect = 4.399e-116
Identity = 205/255 (80.39%), Postives = 229/255 (89.80%), Query Frame = 1
Query:   61 MSCFKGKYADELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCTPGALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPIVEPEILVDGPHDIKKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSEAPKVTPDVIAEHTVRALQRTM 825
            MS F GKYADELIKNA YI TPGKGILAADESTGTIGKRL+SINVEN+E+NR+ALRELLF +P ALQYLSGVILFEETLYQK++ GKPFV++L+E  V+PGIKVDKG VELAGT+GETTTQG D L  RCQ+YY+AGARFAKWRAVLKIGPNEPS+L+I +NA GLARYAIICQENGLV  VEPEIL DG HDI KCA VTE VLAACYKALND HVLLEGTLLKPNMVTPGS++PKV+P+VI E+TV AL+RT+
Sbjct:    1 MSAFVGKYADELIKNAKYIATPGKGILAADESTGTIGKRLASINVENIEANRQALRELLFTSPNALQYLSGVILFEETLYQKSSEGKPFVEILQENNVIPGIKVDKGVVELAGTDGETTTQGFDSLGARCQQYYKAGARFAKWRAVLKIGPNEPSELSIQQNAQGLARYAIICQENGLVLFVEPEILTDGSHDIAKCAAVTETVLAACYKALNDQHVLLEGTLLKPNMVTPGSDSPKVSPEVIGEYTVNALRRTV 255          
BLAST of FC929062 vs. ExPASy Swiss-Prot
Match: ALF_ARATH (Fructose-bisphosphate aldolase, cytoplasmic isozyme OS=Arabidopsis thaliana GN=At4g26520 PE=2 SV=2)

HSP 1 Score: 385.956 bits (990), Expect = 1.419e-106
Identity = 194/255 (76.08%), Postives = 215/255 (84.31%), Query Frame = 1
Query:   61 MSCFKGKYADELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCTPGALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPIVEPEILVDGPHDIKKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSEAPKVTPDVIAEHTVRALQRTM 825
            MS F  KY DELIK A YI TPG+GILAADEST TIGKR + INVEN ESNR+A RELLF +PG+   LSGVILFEETLYQKT+ GKPFVD+L E GV+PGIKVDKG V+LAGTNGETTTQGLD L  RCQ+YYEAGARFAKWRA  KIG  EPS L+I E+A  LARYAIICQENGLVPIVEPE+L  G HDIKKCA VTE VLAA +KALN HHVLLEGTLLKPNMVTPGS++PKV P++IAE+TV AL+RT+
Sbjct:    1 MSAFVSKYEDELIKTAKYIATPGRGILAADESTETIGKRFAGINVENTESNRQAYRELLFTSPGSYPCLSGVILFEETLYQKTSDGKPFVDLLMENGVIPGIKVDKGLVDLAGTNGETTTQGLDSLGARCQQYYEAGARFAKWRAFFKIGATEPSVLSIQEDARVLARYAIICQENGLVPIVEPEVLTGGSHDIKKCAAVTETVLAAVFKALNYHHVLLEGTLLKPNMVTPGSDSPKVAPELIAEYTVTALRRTV 255          
BLAST of FC929062 vs. ExPASy Swiss-Prot
Match: ALF_DICDI (Fructose-bisphosphate aldolase OS=Dictyostelium discoideum GN=fba PE=3 SV=1)

HSP 1 Score: 318.546 bits (815), Expect = 2.781e-86
Identity = 168/253 (66.40%), Postives = 198/253 (78.26%), Query Frame = 1
Query:   79 KYADELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCTP-GALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKI--GPNEPSQLAINENANGLARYAIICQENGLVPIVEPEILVDGPHDIKKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSEAP-KVTPDVIAEHTVRALQRTM 825
            K+ADELI  A  I  PGKGILAADEST TIG R   IN+EN E NRRA RELL  T  G  +++ G+IL+EETLYQK A G+ F DVL+E  +  GIKVDKG V + GT+GET+TQGLDGLA+RC+KYYEAGARFAKWRAVLKI    N PSQL+I ENA+ LARYA ICQENGLVPIVEPEIL+DG H +++ A+VTE+VLAA +KALNDHH+LLEG LLKPNMV  G++ P K T + I + TVR LQRT+
Sbjct:    4 KFADELIATAKAIVAPGKGILAADESTNTIGARFKKINLENNEENRRAYRELLIGTGNGVNEFIGGIILYEETLYQKMADGRLFTDVLREQKIHIGIKVDKGVVPIPGTDGETSTQGLDGLAERCKKYYEAGARFAKWRAVLKIDLAKNCPSQLSITENAHTLARYAAICQENGLVPIVEPEILMDGNHTVEQSAEVTEKVLAAVFKALNDHHILLEGALLKPNMVVNGTDCPIKATSEQIGKFTVRTLQRTV 256          
BLAST of FC929062 vs. ExPASy Swiss-Prot
Match: ALF2_LAMJA (Fructose-bisphosphate aldolase, non-muscle type OS=Lampetra japonica PE=2 SV=1)

HSP 1 Score: 306.22 bits (783), Expect = 1.428e-82
Identity = 161/247 (65.18%), Postives = 192/247 (77.73%), Query Frame = 1
Query:   91 ELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCT-PGALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPIVEPEILVDGPHDIKKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSEAP-KVTPDVIAEHTVRALQRTM 825
            EL + A  I + GKGILAADESTGT+GKRLS+I VENV+ NRR  R+LLF + P   + + GVI +EETLYQKT  G PFV ++K+ G++ GIKVDKGTV LAGT+GE+TTQGLDGLA+RC +Y + GA FAKWR VLKI  N PS LAI ENAN LARYA ICQ+NGLVPIVEPEIL DG HD+K C  VTE+VLAA YKAL+DHHV LEG+LLKPNMVT G  +  + +P  +A  TV AL+RT+
Sbjct:   15 ELAEIAQRIVSNGKGILAADESTGTMGKRLSAIKVENVDENRRVYRQLLFSSDPSVTKAIGGVIFYEETLYQKTDDGTPFVKLIKDRGIVVGIKVDKGTVPLAGTDGESTTQGLDGLAERCARYKKDGADFAKWRCVLKISKNTPSALAIAENANVLARYASICQQNGLVPIVEPEILPDGDHDLKTCQYVTEKVLAATYKALSDHHVYLEGSLLKPNMVTAGQASKIRCSPQEVAMATVTALRRTV 261          
BLAST of FC929062 vs. ExPASy Swiss-Prot
Match: ALF1_LAMJA (Fructose-bisphosphate aldolase, muscle type OS=Lampetra japonica PE=2 SV=1)

HSP 1 Score: 305.449 bits (781), Expect = 2.436e-82
Identity = 158/247 (63.97%), Postives = 189/247 (76.52%), Query Frame = 1
Query:   91 ELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCT-PGALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPIVEPEILVDGPHDIKKCADVTERVLAACYKALNDHHVLLEGTLLKPNMVTPGSEAPKVT-PDVIAEHTVRALQRTM 825
            EL   A  I   GKGILAADES GT+GKRL+ I +EN + +RR  R+LLF T P   +++ G+I F ET+YQKT  G PFV ++K+ G+L GIKVDKG V LAGTNGE TTQGLDGLA+RC +Y + GA FAKWR VLKI PN PS+L+I ENAN LARYA ICQ+NGLVPIVEPEIL DG HD+K C  +TE+VLAA YKAL+DHHV LEGTLLKPNMVT G+ AP  T P+ +A  T+ AL+RT+
Sbjct:   15 ELADIAQRIVASGKGILAADESVGTMGKRLTQIGLENTDEHRRFYRQLLFTTDPSIKEHIGGIIFFHETMYQKTDGGVPFVKLVKDNGILVGIKVDKGVVPLAGTNGEGTTQGLDGLAERCAQYKKDGADFAKWRCVLKISPNTPSRLSIVENANVLARYATICQQNGLVPIVEPEILPDGDHDLKTCQYITEKVLAATYKALSDHHVYLEGTLLKPNMVTVGTAAPASTRPEQVAMATLTALRRTV 261          
The following BLAST results are available for this feature:
BLAST of FC929062 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 56
Match NameE-valueIdentityDescription
ALF_MAIZE7.487e-12486.67Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]
ALF_ORYSJ3.716e-12386.27Fructose-bisphosphate aldolase cytoplasmic isozyme... [more]
ALF_SPIOL1.412e-12285.88Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]
ALF2_PEA1.322e-12086.33Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]
ALF_CICAR1.119e-11985.16Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]
ALF1_PEA4.399e-11680.39Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]
ALF_ARATH1.419e-10676.08Fructose-bisphosphate aldolase, cytoplasmic isozym... [more]
ALF_DICDI2.781e-8666.40Fructose-bisphosphate aldolase OS=Dictyostelium di... [more]
ALF2_LAMJA1.428e-8265.18Fructose-bisphosphate aldolase, non-muscle type OS... [more]
ALF1_LAMJA2.436e-8263.97Fructose-bisphosphate aldolase, muscle type OS=Lam... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAH3CA11RM1 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH3CA11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929062 ID=FC929062|Name=FC929062|organism=Citrus clementina|type=EST|length=826bp
GGCACGAGGCTCTGTTTCTCCCTCTAACAAAACAAATTTTCTATCTTCAA
GTCGATCACCATGTCTTGCTTCAAGGGCAAATACGCCGATGAGCTCATTA
AAAACGCTGCCTACATTGGCACCCCTGGAAAGGGTATCCTTGCTGCTGAT
GAGTCAACAGGCACCATTGGCAAGCGTCTATCCAGCATCAATGTTGAGAA
TGTTGAGTCAAACAGGCGTGCTCTCCGCGAGCTCCTTTTCTGCACTCCCG
GTGCCCTTCAGTACCTCAGTGGTGTCATCCTCTTCGAGGAGACCCTCTAC
CAGAAGACTGCTGCTGGCAAGCCCTTTGTTGATGTCTTGAAGGAGGGTGG
AGTCCTCCCTGGAATTAAGGTTGACAAGGGTACTGTTGAGCTTGCTGGTA
CCAATGGTGAGACCACCACCCAGGGTCTTGATGGCCTCGCCCAGCGCTGC
CAGAAATACTATGAAGCTGGTGCTCGTTTTGCCAAATGGCGTGCTGTTCT
TAAGATTGGCCCTAATGAGCCTTCGCAGCTGGCCATCAATGAGAATGCCA
ATGGCCTGGCCCGATATGCTATCATCTGCCAGGAGAATGGCCTTGTTCCC
ATTGTTGAACCTGAGATCCTTGTTGACGGTCCCCATGACATCAAGAAGTG
TGCTGATGTGACCGAGCGTGTTCTTGCTGCATGCTACAAGGCTCTGAATG
ACCACCATGTCCTTCTTGAGGGTACCCTTTTGAAGCCCAACATGGTGACC
CCTGGATCTGAAGCTCCCAAAGTTACACCGGACGTGATTGCTGAACACAC
TGTCCGGGCCCTGCAACGCACTATGC
back to top