FC929070

Overview
NameFC929070
Unique NameFC929070
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length728
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
FC929070_ssr15 microsatellite FC929070_ssr15:15..26. BLAST: Citrus ESTs to Prunus persica proteins V1
Ccv1_Contig15033 contig Ccv1_Contig15033:1..728. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929070 vs. ExPASy Swiss-Prot
Match: RK1_SPIOL (50S ribosomal protein L1, chloroplastic OS=Spinacia oleracea GN=RPL1 PE=1 SV=1)

HSP 1 Score: 131.339 bits (329), Expect = 5.059e-30
Identity = 65/71 (91.55%), Postives = 68/71 (95.77%), Query Frame = 2
Query:  515 DRTRSKRFLEIQNLREGKKEYDLKTAISLLKQMSSTKFTETAEAHFRLNIDPKYNDQQLRATVSLPKGTGK 727
            DRTRSKRFLEIQ LRE K+EYDLKTA+SL+KQMSSTKF ETAEAHFRLNIDPKYNDQQLRATVSLPKGTGK
Sbjct:  115 DRTRSKRFLEIQKLREIKQEYDLKTALSLMKQMSSTKFVETAEAHFRLNIDPKYNDQQLRATVSLPKGTGK 185          
BLAST of FC929070 vs. ExPASy Swiss-Prot
Match: RK1_PEA (50S ribosomal protein L1, chloroplastic (Fragment) OS=Pisum sativum GN=RPL1 PE=2 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 1.055e-27
Identity = 61/71 (85.92%), Postives = 64/71 (90.14%), Query Frame = 2
Query:  515 DRTRSKRFLEIQNLREGKKEYDLKTAISLLKQMSSTKFTETAEAHFRLNIDPKYNDQQLRATVSLPKGTGK 727
            DR RSKRFLEIQ LRE KKEYDLKTAISL+K+ + TKF ET EAHFRLNIDPKYNDQQLRATVSLPKGTGK
Sbjct:   53 DRVRSKRFLEIQKLRELKKEYDLKTAISLVKETAKTKFVETVEAHFRLNIDPKYNDQQLRATVSLPKGTGK 123          
BLAST of FC929070 vs. ExPASy Swiss-Prot
Match: RK1_ARATH (50S ribosomal protein L1, chloroplastic OS=Arabidopsis thaliana GN=RPL1 PE=1 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 1.055e-27
Identity = 60/72 (83.33%), Postives = 66/72 (91.67%), Query Frame = 2
Query:  512 RDRTRSKRFLEIQNLREGKKEYDLKTAISLLKQMSSTKFTETAEAHFRLNIDPKYNDQQLRATVSLPKGTGK 727
            RDRTRSKRFLEIQ LRE KKEYD+ TAISLLKQ ++T+F E+ EAHFRLNIDPKYNDQQLRATVSLPKGTG+
Sbjct:  108 RDRTRSKRFLEIQKLRETKKEYDVNTAISLLKQTANTRFVESVEAHFRLNIDPKYNDQQLRATVSLPKGTGQ 179          
BLAST of FC929070 vs. ExPASy Swiss-Prot
Match: RK1_CYAME (50S ribosomal protein L1, chloroplastic OS=Cyanidioschyzon merolae GN=rpl1 PE=3 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 2.980e-14
Identity = 40/68 (58.82%), Postives = 51/68 (75.00%), Query Frame = 2
Query:  524 RSKRFLEIQNLREGKKEYDLKTAISLLKQMSSTKFTETAEAHFRLNIDPKYNDQQLRATVSLPKGTGK 727
            RSKR+  + +L E K  Y  + A+ LLK++++ KF ETAEAH RLN+DPKY DQQ+RATV LP GTGK
Sbjct:    3 RSKRYQSLCSLIEPKL-YSPQEALKLLKKLATAKFVETAEAHIRLNLDPKYTDQQIRATVVLPHGTGK 69          
BLAST of FC929070 vs. ExPASy Swiss-Prot
Match: RL1_MICAN (50S ribosomal protein L1 OS=Microcystis aeruginosa (strain NIES-843) GN=rplA PE=3 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 1.931e-13
Identity = 39/67 (58.21%), Postives = 49/67 (73.13%), Query Frame = 2
Query:  527 SKRFLEIQNLREGKKEYDLKTAISLLKQMSSTKFTETAEAHFRLNIDPKYNDQQLRATVSLPKGTGK 727
            S+R  + Q   E K  Y+   A++LLK++++ KF ETAEAH RL IDPKY DQQLR TVSLPKGTG+
Sbjct:    6 SRRLRDAQAKVENKA-YEPLEALTLLKELATAKFDETAEAHIRLGIDPKYTDQQLRTTVSLPKGTGR 71          
BLAST of FC929070 vs. ExPASy Swiss-Prot
Match: RK1_CYAPA (50S ribosomal protein L1, cyanelle OS=Cyanophora paradoxa GN=rpl1 PE=3 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 2.523e-13
Identity = 40/70 (57.14%), Postives = 50/70 (71.43%), Query Frame = 2
Query:  518 RTRSKRFLEIQNLREGKKEYDLKTAISLLKQMSSTKFTETAEAHFRLNIDPKYNDQQLRATVSLPKGTGK 727
            + RS+R  E+    E ++ Y+   AI LLKQ+S+ KF ET E H RL IDPKYNDQQLRATV+LP GTG+
Sbjct:    2 KKRSRRMQELVGKVE-EQLYEPLEAIQLLKQISTAKFIETVEVHCRLGIDPKYNDQQLRATVTLPNGTGQ 70          
BLAST of FC929070 vs. ExPASy Swiss-Prot
Match: RL1_THEM4 (50S ribosomal protein L1 OS=Thermosipho melanesiensis (strain BI429 / DSM 12029) GN=rplA PE=3 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 4.303e-13
Identity = 34/67 (50.75%), Postives = 49/67 (73.13%), Query Frame = 2
Query:  527 SKRFLEIQNLREGKKEYDLKTAISLLKQMSSTKFTETAEAHFRLNIDPKYNDQQLRATVSLPKGTGK 727
            SKR+ E++ L +  KEYDL  A+ L K++++ KF ET E H + NID + +DQQ+R+T+SLP GTGK
Sbjct:    5 SKRYNEVRKLVDRTKEYDLNEAVDLAKKVATAKFDETVELHIKTNIDYRKSDQQIRSTISLPHGTGK 71          
BLAST of FC929070 vs. ExPASy Swiss-Prot
Match: RL1_ANAVT (50S ribosomal protein L1 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=rplA PE=3 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 4.303e-13
Identity = 39/67 (58.21%), Postives = 48/67 (71.64%), Query Frame = 2
Query:  527 SKRFLEIQNLREGKKEYDLKTAISLLKQMSSTKFTETAEAHFRLNIDPKYNDQQLRATVSLPKGTGK 727
            S+R  E+Q   E + EY    A+SLLK+ ++ KF E AEAH RL IDPKY DQQLR TV+LPKGTG+
Sbjct:    6 SRRLRELQAKVEDR-EYGPLDALSLLKETATAKFAEAAEAHIRLGIDPKYTDQQLRTTVALPKGTGQ 71          
BLAST of FC929070 vs. ExPASy Swiss-Prot
Match: RL1_CYAP8 (50S ribosomal protein L1 OS=Cyanothece sp. (strain PCC 8801) GN=rplA PE=3 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 5.620e-13
Identity = 38/67 (56.72%), Postives = 46/67 (68.66%), Query Frame = 2
Query:  527 SKRFLEIQNLREGKKEYDLKTAISLLKQMSSTKFTETAEAHFRLNIDPKYNDQQLRATVSLPKGTGK 727
            SKRF E     +  + Y    A+ LLK+ ++ KF E+AEAH RL IDPKY DQQLR TVSLPKGTG+
Sbjct:    6 SKRFKEALAKVDQNQTYAPLEALQLLKETATAKFNESAEAHIRLGIDPKYTDQQLRTTVSLPKGTGQ 72          
BLAST of FC929070 vs. ExPASy Swiss-Prot
Match: RL1_TRIEI (50S ribosomal protein L1 OS=Trichodesmium erythraeum (strain IMS101) GN=rplA PE=3 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 7.339e-13
Identity = 37/67 (55.22%), Postives = 49/67 (73.13%), Query Frame = 2
Query:  527 SKRFLEIQNLREGKKEYDLKTAISLLKQMSSTKFTETAEAHFRLNIDPKYNDQQLRATVSLPKGTGK 727
            S+R  E++   E ++ Y+ K A+ LLK+ ++ KF E AEAH RL IDPKY DQQLR TV+LPKGTG+
Sbjct:    6 SRRLQELRKKVE-ERPYEPKEALQLLKETATAKFLEAAEAHVRLGIDPKYTDQQLRTTVALPKGTGQ 71          
The following BLAST results are available for this feature:
BLAST of FC929070 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 41
Match NameE-valueIdentityDescription
RK1_SPIOL5.059e-3091.5550S ribosomal protein L1, chloroplastic OS=Spinaci... [more]
RK1_PEA1.055e-2785.9250S ribosomal protein L1, chloroplastic (Fragment)... [more]
RK1_ARATH1.055e-2783.3350S ribosomal protein L1, chloroplastic OS=Arabido... [more]
RK1_CYAME2.980e-1458.8250S ribosomal protein L1, chloroplastic OS=Cyanidi... [more]
RL1_MICAN1.931e-1358.2150S ribosomal protein L1 OS=Microcystis aeruginosa... [more]
RK1_CYAPA2.523e-1357.1450S ribosomal protein L1, cyanelle OS=Cyanophora p... [more]
RL1_THEM44.303e-1350.7550S ribosomal protein L1 OS=Thermosipho melanesien... [more]
RL1_ANAVT4.303e-1358.2150S ribosomal protein L1 OS=Anabaena variabilis (s... [more]
RL1_CYAP85.620e-1356.7250S ribosomal protein L1 OS=Cyanothece sp. (strain... [more]
RL1_TRIEI7.339e-1355.2250S ribosomal protein L1 OS=Trichodesmium erythrae... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAH1DE09RM2 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH1DE09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929070 ID=FC929070|Name=FC929070|organism=Citrus clementina|type=EST|length=728bp
GGCACGAGGTCTTATCTTCTTCTTCTCGGACTTTTTTTCTGGGTAGGTAT
AGCAATTTGCAATAGCAGTGCATATATACAAATTACAAAACTCAAAAAGG
TTCCAATACTGTATCCGCAAAATGGCGACATGTGGCACTACTCCGTCGTC
TCTGATGCTAACATACGCCGCCACGCCAGTACACCCGCAAGACTTGACAC
CCTCGCTGTCTCTTCTTTCTTTCAAACCCTCGAAGACTGCGGCTTTCTCA
CTGTGCACCAACCTCAGCGTTAGAGGAGGGGAGAGGAGGGCGAGCAAGTG
GCTTGATTTGTATCCGCTGAGACAGAACAAAAATGGGCTTCCTGGACACA
TGCTGGCGGCTGCTTCTGCTGTCGAAGCTGATACTGACTTGGCCACTGAC
GATGTGGAGGACGATACTCAGGGAGGTGCTGAAGGAGCAACTGCTACTGC
TACTGCTACTGCTACTATTTCAACTAAGCCTAAGAAAGGCAAGGCTGCGT
TGCCTCTCAAGAGAGACAGGACTAGGTCTAAAAGATTCCTGGAAATTCAA
AATTTGAGGGAAGGCAAGAAAGAGTATGATTTGAAGACGGCAATATCTTT
GTTGAAGCAGATGTCAAGTACAAAGTTCACGGAAACAGCTGAAGCCCATT
TTCGCCTCAACATTGATCCCAAATACAATGATCAACAGCTTAGAGCAACA
GTGAGTTTACCCAAGGGAACTGGAAAAT
back to top