FC929072

Overview
NameFC929072
Unique NameFC929072
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length381
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15023 contig Ccv1_Contig15023:1..381. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929072 vs. ExPASy Swiss-Prot
Match: Y5621_ARATH (PHD finger protein At5g26210 OS=Arabidopsis thaliana GN=At5g26210 PE=1 SV=2)

HSP 1 Score: 73.559 bits (179), Expect = 3.633e-13
Identity = 30/36 (83.33%), Postives = 33/36 (91.67%), Query Frame = 3
Query:    3 DICERWFHGKCVKITPAKAENIKQYKCPSCSMKRGR 110
            D+CE WFHGKCVKITPA+AE+IKQYKCPSCS KR R
Sbjct:  219 DLCEMWFHGKCVKITPARAEHIKQYKCPSCSNKRAR 254          
The following BLAST results are available for this feature:
BLAST of FC929072 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
Y5621_ARATH3.633e-1383.33PHD finger protein At5g26210 OS=Arabidopsis thalia... [more]
back to top
Properties
Property NameValue
Genbank descriptionKN0AAH1DE11RM2 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH1DE11, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929072 ID=FC929072|Name=FC929072|organism=Citrus clementina|type=EST|length=381bp
GTGACATCTGTGAGAGGTGGTTCCATGGGAAGTGTGTGAAGATAACACCC
GCTAAGGCTGAGAATATTAAGCAATACAAATGCCCATCTTGCAGCATGAA
GAGAGGCAGGCAGTAGTAGTCTTTAAAACCGATTTACCATTGGAGTGGTT
CAAAGAGCGTTCCTCTGTGGCTGACATAGTATAGAAATGTCAACTTTTAA
AAGTTAAAAAAGTTATGTAATGAATTTGTCGTGATGTTTGTTCATACAAG
TTGCTTTGAAGGGCTTCTGCCCAGATGAATCCTTAAGATTTTAACTTATA
AATATTAGAATTTGTTATTTTTCGACAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
back to top