FC929081

Overview
NameFC929081
Unique NameFC929081
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length854
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15034 contig Ccv1_Contig15034:1..854. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929081 vs. ExPASy Swiss-Prot
Match: EXS_ARATH (Leucine-rich repeat receptor protein kinase EXS OS=Arabidopsis thaliana GN=EXS PE=1 SV=1)

HSP 1 Score: 437.187 bits (1123), Expect = 5.610e-122
Identity = 216/284 (76.06%), Postives = 244/284 (85.92%), Query Frame = 3
Query:    3 QPLMRLTLVHILEATNNFCKTNIIGDGGFGTVYKAALPDGKTVAVKKLSQAKTQGHREFTAEMETLGKVKHQNLVPLLGYCSFGEEKLLVYEYMVNGSLDLWLRNRTGSLEVLGWDKRYKIACGAARGLAFLHHGFTPHIIHRDIKASNILLNEEFEAKVADFGLARLISACETHVSTDIAGTFGYIPPEYGQSGRSTTRGDVYSFGVILLELVTGKEPTGPEFKDIEGGNLVGWVFQKMKKGQAADVLDPTVLTADSKPMMLKMLRIAGDCLSDNPAMRPTML 854
            QPL+++ L  I+EAT++F K NIIGDGGFGTVYKA LP  KTVAVKKLS+AKTQG+REF AEMETLGKVKH NLV LLGYCSF EEKLLVYEYMVNGSLD WLRN+TG LEVL W KR KIA GAARGLAFLHHGF PHIIHRDIKASNILL+ +FE KVADFGLARLISACE+HVST IAGTFGYIPPEYGQS R+TT+GDVYSFGVILLELVTGKEPTGP+FK+ EGGNLVGW  QK+ +G+A DV+DP +++   K   L++L+IA  CL++ PA RP ML
Sbjct:  900 QPLLKVRLGDIVEATDHFSKKNIIGDGGFGTVYKACLPGEKTVAVKKLSEAKTQGNREFMAEMETLGKVKHPNLVSLLGYCSFSEEKLLVYEYMVNGSLDHWLRNQTGMLEVLDWSKRLKIAVGAARGLAFLHHGFIPHIIHRDIKASNILLDGDFEPKVADFGLARLISACESHVSTVIAGTFGYIPPEYGQSARATTKGDVYSFGVILLELVTGKEPTGPDFKESEGGNLVGWAIQKINQGKAVDVIDPLLVSVALKNSQLRLLQIAMLCLAETPAKRPNML 1183          
BLAST of FC929081 vs. ExPASy Swiss-Prot
Match: BRL3_ARATH (Receptor-like protein kinase BRI1-like 3 OS=Arabidopsis thaliana GN=BRL3 PE=1 SV=1)

HSP 1 Score: 323.168 bits (827), Expect = 1.181e-87
Identity = 166/287 (57.84%), Postives = 211/287 (73.52%), Query Frame = 3
Query:    3 QPLMRLTLVHILEATNNFCKTNIIGDGGFGTVYKAALPDGKTVAVKKLSQAKTQGHREFTAEMETLGKVKHQNLVPLLGYCSFGEEKLLVYEYMVNGSLDLWLRNRTGSLEV-LGWDKRYKIACGAARGLAFLHHGFTPHIIHRDIKASNILLNEEFEAKVADFGLARLISACETHVS-TDIAGTFGYIPPEYGQSGRSTTRGDVYSFGVILLELVTGKEPTGPEFKDIEGGNLVGWVFQKMKKGQAADVLDPTVLTADSKPM-MLKMLRIAGDCLSDNPAMRPTML 854
            +PL +LT  H+LEATN F   ++IG GGFG VYKA L DG  VA+KKL Q   QG REF AEMET+GK+KH+NLVPLLGYC  GEE+LLVYEYM  GSL+  L  +T    + L W  R KIA GAARGLAFLHH   PHIIHRD+K+SN+LL+++F A+V+DFG+ARL+SA +TH+S + +AGT GY+PPEY QS R T +GDVYS+GVILLEL++GK+P  PE +  E  NLVGW  Q  ++ + A++LDP ++T  S  + +L  L+IA  CL D P  RPTM+
Sbjct:  841 KPLRKLTFAHLLEATNGFSADSMIGSGGFGDVYKAKLADGSVVAIKKLIQVTGQGDREFMAEMETIGKIKHRNLVPLLGYCKIGEERLLVYEYMKYGSLETVLHEKTKKGGIFLDWSARKKIAIGAARGLAFLHHSCIPHIIHRDMKSSNVLLDQDFVARVSDFGMARLVSALDTHLSVSTLAGTPGYVPPEYYQSFRCTAKGDVYSYGVILLELLSGKKPIDPE-EFGEDNNLVGWAKQLYREKRGAEILDPELVTDKSGDVELLHYLKIASQCLDDRPFKRPTMI 1126          
BLAST of FC929081 vs. ExPASy Swiss-Prot
Match: BRL1_ARATH (Serine/threonine-protein kinase BRI1-like 1 OS=Arabidopsis thaliana GN=BRL1 PE=1 SV=1)

HSP 1 Score: 317.775 bits (813), Expect = 4.960e-86
Identity = 165/289 (57.09%), Postives = 209/289 (72.32%), Query Frame = 3
Query:    3 QPLMRLTLVHILEATNNFCKTNIIGDGGFGTVYKAALPDGKTVAVKKLSQAKTQGHREFTAEMETLGKVKHQNLVPLLGYCSFGEEKLLVYEYMVNGSLDLWLRNRTGSLE--VLGWDKRYKIACGAARGLAFLHHGFTPHIIHRDIKASNILLNEEFEAKVADFGLARLISACETHVS-TDIAGTFGYIPPEYGQSGRSTTRGDVYSFGVILLELVTGKEPTGP-EFKDIEGGNLVGWVFQKMKKGQAADVLDPTVLTADSKPM-MLKMLRIAGDCLSDNPAMRPTML 854
            +PL +LT  H+LEATN F    ++G GGFG VYKA L DG  VA+KKL +   QG REF AEMET+GK+KH+NLVPLLGYC  GEE+LLVYEYM  GSL+  L  ++       L W  R KIA GAARGLAFLHH   PHIIHRD+K+SN+LL+E+FEA+V+DFG+ARL+SA +TH+S + +AGT GY+PPEY QS R T +GDVYS+GVILLEL++GK+P  P EF   E  NLVGW  Q  ++ + A++LDP ++T  S  + +   L+IA  CL D P  RPTM+
Sbjct:  842 KPLRKLTFAHLLEATNGFSAETMVGSGGFGEVYKAQLRDGSVVAIKKLIRITGQGDREFMAEMETIGKIKHRNLVPLLGYCKVGEERLLVYEYMKWGSLETVLHEKSSKKGGIYLNWAARKKIAIGAARGLAFLHHSCIPHIIHRDMKSSNVLLDEDFEARVSDFGMARLVSALDTHLSVSTLAGTPGYVPPEYYQSFRCTAKGDVYSYGVILLELLSGKKPIDPGEFG--EDNNLVGWAKQLYREKRGAEILDPELVTDKSGDVELFHYLKIASQCLDDRPFKRPTMI 1128          
BLAST of FC929081 vs. ExPASy Swiss-Prot
Match: BRI1_SOLPE (Systemin receptor SR160 OS=Solanum peruvianum PE=1 SV=1)

HSP 1 Score: 310.071 bits (793), Expect = 1.034e-83
Identity = 163/287 (56.79%), Postives = 207/287 (72.13%), Query Frame = 3
Query:    3 QPLMRLTLVHILEATNNFCKTNIIGDGGFGTVYKAALPDGKTVAVKKLSQAKTQGHREFTAEMETLGKVKHQNLVPLLGYCSFGEEKLLVYEYMVNGSLDLWLRNRTGSLEVLGWDKRYKIACGAARGLAFLHHGFTPHIIHRDIKASNILLNEEFEAKVADFGLARLISACETHVS-TDIAGTFGYIPPEYGQSGRSTTRGDVYSFGVILLELVTGKEPTGPEFKDIEGGNLVGWVFQKMKKGQAADVLDPTVLTADS--KPMMLKMLRIAGDCLSDNPAMRPTML 854
            +PL +LT   +LEATN F   +++G GGFG VYKA L DG  VA+KKL     QG REFTAEMET+GK+KH+NLVPLLGYC  GEE+LLVYEYM  GSL+  L +R  +   L W  R KIA GAARGLAFLHH   PHIIHRD+K+SN+LL+E  EA+V+DFG+ARL+SA +TH+S + +AGT GY+PPEY QS R +T+GDVYS+GV+LLEL+TGK+PT  +  D    NLVGWV +   KG+  DV D  +L  D+  +  +L+ L++A  CL D    RPTM+
Sbjct:  871 KPLRKLTFADLLEATNGFHNDSLVGSGGFGDVYKAQLKDGSVVAIKKLIHVSGQGDREFTAEMETIGKIKHRNLVPLLGYCKVGEERLLVYEYMKYGSLEDVLHDRKKTGIKLNWPARRKIAIGAARGLAFLHHNCIPHIIHRDMKSSNVLLDENLEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKQPT--DSADFGDNNLVGWV-KLHAKGKITDVFDRELLKEDASIEIELLQHLKVACACLDDRHWKRPTMI 1154          
BLAST of FC929081 vs. ExPASy Swiss-Prot
Match: BRI1_SOLLC (Brassinosteroid LRR receptor kinase OS=Solanum lycopersicum GN=CURL3 PE=1 SV=1)

HSP 1 Score: 308.916 bits (790), Expect = 2.304e-83
Identity = 163/287 (56.79%), Postives = 206/287 (71.78%), Query Frame = 3
Query:    3 QPLMRLTLVHILEATNNFCKTNIIGDGGFGTVYKAALPDGKTVAVKKLSQAKTQGHREFTAEMETLGKVKHQNLVPLLGYCSFGEEKLLVYEYMVNGSLDLWLRNRTGSLEVLGWDKRYKIACGAARGLAFLHHGFTPHIIHRDIKASNILLNEEFEAKVADFGLARLISACETHVS-TDIAGTFGYIPPEYGQSGRSTTRGDVYSFGVILLELVTGKEPTGPEFKDIEGGNLVGWVFQKMKKGQAADVLDPTVLTADS--KPMMLKMLRIAGDCLSDNPAMRPTML 854
            +PL +LT   +LEATN F   +++G GGFG VYKA L DG  VA+KKL     QG REFTAEMET+GK+KH+NLVPLLGYC  GEE+LLVYEYM  GSL+  L +R      L W  R KIA GAARGLAFLHH   PHIIHRD+K+SN+LL+E  EA+V+DFG+ARL+SA +TH+S + +AGT GY+PPEY QS R +T+GDVYS+GV+LLEL+TGK+PT  +  D    NLVGWV +   KG+  DV D  +L  D+  +  +L+ L++A  CL D    RPTM+
Sbjct:  871 KPLRKLTFADLLEATNGFHNDSLVGSGGFGDVYKAQLKDGSVVAIKKLIHVSGQGDREFTAEMETIGKIKHRNLVPLLGYCKVGEERLLVYEYMKYGSLEDVLHDRKKIGIKLNWPARRKIAIGAARGLAFLHHNCIPHIIHRDMKSSNVLLDENLEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKQPT--DSADFGDNNLVGWV-KLHAKGKITDVFDRELLKEDASIEIELLQHLKVACACLDDRHWKRPTMI 1154          
BLAST of FC929081 vs. ExPASy Swiss-Prot
Match: BRI1_ARATH (Protein BRASSINOSTEROID INSENSITIVE 1 OS=Arabidopsis thaliana GN=BRI1 PE=1 SV=1)

HSP 1 Score: 303.523 bits (776), Expect = 9.681e-82
Identity = 160/288 (55.56%), Postives = 207/288 (71.88%), Query Frame = 3
Query:    3 QPLMRLTLVHILEATNNFCKTNIIGDGGFGTVYKAALPDGKTVAVKKLSQAKTQGHREFTAEMETLGKVKHQNLVPLLGYCSFGEEKLLVYEYMVNGSLDLWLRNRTGSLEVLGWDKRYKIACGAARGLAFLHHGFTPHIIHRDIKASNILLNEEFEAKVADFGLARLISACETHVS-TDIAGTFGYIPPEYGQSGRSTTRGDVYSFGVILLELVTGKEPT-GPEFKDIEGGNLVGWVFQKMKKGQAADVLDPTVLTADS--KPMMLKMLRIAGDCLSDNPAMRPTML 854
            +PL +LT   +L+ATN F   ++IG GGFG VYKA L DG  VA+KKL     QG REF AEMET+GK+KH+NLVPLLGYC  G+E+LLVYE+M  GSL+  L +   +   L W  R KIA G+ARGLAFLHH  +PHIIHRD+K+SN+LL+E  EA+V+DFG+ARL+SA +TH+S + +AGT GY+PPEY QS R +T+GDVYS+GV+LLEL+TGK PT  P+F D    NLVGWV Q  K  + +DV DP ++  D   +  +L+ L++A  CL D    RPTM+
Sbjct:  866 KPLRKLTFADLLQATNGFHNDSLIGSGGFGDVYKAILKDGSAVAIKKLIHVSGQGDREFMAEMETIGKIKHRNLVPLLGYCKVGDERLLVYEFMKYGSLEDVLHDPKKAGVKLNWSTRRKIAIGSARGLAFLHHNCSPHIIHRDMKSSNVLLDENLEARVSDFGMARLMSAMDTHLSVSTLAGTPGYVPPEYYQSFRCSTKGDVYSYGVVLLELLTGKRPTDSPDFGD---NNLVGWVKQHAKL-RISDVFDPELMKEDPALEIELLQHLKVAVACLDDRAWRRPTMV 1149          
BLAST of FC929081 vs. ExPASy Swiss-Prot
Match: BRL2_ARATH (Serine/threonine-protein kinase BRI1-like 2 OS=Arabidopsis thaliana GN=BRL1 PE=1 SV=1)

HSP 1 Score: 295.049 bits (754), Expect = 3.443e-79
Identity = 157/300 (52.33%), Postives = 205/300 (68.33%), Query Frame = 3
Query:    9 LMRLTLVHILEATNNFCKTNIIGDGGFGTVYKAALPDGKTVAVKKLSQAKTQGHREFTAEMETLGKVKHQNLVPLLGYCSFGEEKLLVYEYMVNGSLDLWLRN-RTG-SLEVLGWDKRYKIACGAARGLAFLHHGFTPHIIHRDIKASNILLNEEFEAKVADFGLARLISACETHVS-TDIAGTFGYIPPEYGQSGRSTTRGDVYSFGVILLELVTGKEPTGPEFKDIEGGNLVGWVFQKMKKGQAADVLDPTVLTADSKPM---------------MLKMLRIAGDCLSDNPAMRPTML 854
            L +L    ++EATN F   ++IG GGFG V+KA L DG +VA+KKL +   QG REF AEMETLGK+KH+NLVPLLGYC  GEE+LLVYE+M  GSL+  L   RTG    +LGW++R KIA GAA+GL FLHH   PHIIHRD+K+SN+LL+++ EA+V+DFG+ARLISA +TH+S + +AGT GY+PPEY QS R T +GDVYS GV++LE+++GK PT  E  +    NLVGW   K ++G+  +V+D  +L   S                  ML+ L IA  C+ D P+ RP ML
Sbjct:  823 LRKLKFSQLIEATNGFSAASMIGHGGFGEVFKATLKDGSSVAIKKLIRLSCQGDREFMAEMETLGKIKHRNLVPLLGYCKIGEERLLVYEFMQYGSLEEVLHGPRTGEKRRILGWEERKKIAKGAAKGLCFLHHNCIPHIIHRDMKSSNVLLDQDMEARVSDFGMARLISALDTHLSVSTLAGTPGYVPPEYYQSFRCTAKGDVYSIGVVMLEILSGKRPTDKE--EFGDTNLVGWSKMKAREGKHMEVIDEDLLKEGSSESLNEKEGFEGGVIVKEMLRYLEIALRCVDDFPSKRPNML 1120          
BLAST of FC929081 vs. ExPASy Swiss-Prot
Match: PSKR1_ARATH (Phytosulfokine receptor 1 OS=Arabidopsis thaliana GN=PSKR1 PE=2 SV=4)

HSP 1 Score: 292.738 bits (748), Expect = 1.709e-78
Identity = 147/272 (54.04%), Postives = 191/272 (70.22%), Query Frame = 3
Query:   33 ILEATNNFCKTNIIGDGGFGTVYKAALPDGKTVAVKKLSQAKTQGHREFTAEMETLGKVKHQNLVPLLGYCSFGEEKLLVYEYMVNGSLDLWLRNRTGSLEVLGWDKRYKIACGAARGLAFLHHGFTPHIIHRDIKASNILLNEEFEAKVADFGLARLISACETHVSTDIAGTFGYIPPEYGQSGRSTTRGDVYSFGVILLELVTGKEPTGPEFKDIEGGNLVGWVFQKMKKGQAADVLDPTVLTADSKPMMLKMLRIAGDCLSDNPAMRPT 848
            +L++TN+F + NIIG GGFG VYKA LPDGK VA+KKLS    Q  REF AE+ETL + +H NLV L G+C +  ++LL+Y YM NGSLD WL  R     +L W  R +IA GAA+GL +LH G  PHI+HRDIK+SNILL+E F + +ADFGLARL+S  ETHVSTD+ GT GYIPPEYGQ+  +T +GDVYSFGV+LLEL+T K P     K     +L+ WV +   + +A++V DP + + ++   M ++L IA  CLS+NP  RPT
Sbjct:  727 LLDSTNSFDQANIIGCGGFGMVYKATLPDGKKVAIKKLSGDCGQIEREFEAEVETLSRAQHPNLVLLRGFCFYKNDRLLIYSYMENGSLDYWLHERNDGPALLKWKTRLRIAQGAAKGLLYLHEGCDPHILHRDIKSSNILLDENFNSHLADFGLARLMSPYETHVSTDLVGTLGYIPPEYGQASVATYKGDVYSFGVVLLELLTDKRPV-DMCKPKGCRDLISWVVKMKHESRASEVFDPLIYSKENDKEMFRVLEIACLCLSENPKQRPT 997          
BLAST of FC929081 vs. ExPASy Swiss-Prot
Match: PSKR1_DAUCA (Phytosulfokine receptor 1 OS=Daucus carota GN=PSKR PE=1 SV=1)

HSP 1 Score: 288.5 bits (737), Expect = 3.223e-77
Identity = 147/277 (53.07%), Postives = 189/277 (68.23%), Query Frame = 3
Query:   18 LTLVHILEATNNFCKTNIIGDGGFGTVYKAALPDGKTVAVKKLSQAKTQGHREFTAEMETLGKVKHQNLVPLLGYCSFGEEKLLVYEYMVNGSLDLWLRNRTGSLEVLGWDKRYKIACGAARGLAFLHHGFTPHIIHRDIKASNILLNEEFEAKVADFGLARLISACETHVSTDIAGTFGYIPPEYGQSGRSTTRGDVYSFGVILLELVTGKEPTGPEFKDIEGGNLVGWVFQKMKKGQAADVLDPTVLTADSKPMMLKMLRIAGDCLSDNPAMRPT 848
            L+L  IL++T++F + NIIG GGFG VYKA LPDG  VA+K+LS    Q  REF AE+ETL + +H NLV LLGYC++  +KLL+Y YM NGSLD WL  +      L W  R +IA GAA GLA+LH    PHI+HRDIK+SNILL++ F A +ADFGLARLI   +THV+TD+ GT GYIPPEYGQ+  +T +GDVYSFGV+LLEL+TG+ P     K     +L+ WV Q   + + +++ DP +   D    ML +L IA  CL +NP  RPT
Sbjct:  731 LSLDDILKSTSSFNQANIIGCGGFGLVYKATLPDGTKVAIKRLSGDTGQMDREFQAEVETLSRAQHPNLVHLLGYCNYKNDKLLIYSYMDNGSLDYWLHEKVDGPPSLDWKTRLRIARGAAEGLAYLHQSCEPHILHRDIKSSNILLSDTFVAHLADFGLARLILPYDTHVTTDLVGTLGYIPPEYGQASVATYKGDVYSFGVVLLELLTGRRPM-DVCKPRGSRDLISWVLQMKTEKRESEIFDPFIYDKDHAEEMLLVLEIACRCLGENPKTRPT 1006          
BLAST of FC929081 vs. ExPASy Swiss-Prot
Match: PSKR2_ARATH (Phytosulfokine receptor 2 OS=Arabidopsis thaliana GN=PSKR2 PE=2 SV=1)

HSP 1 Score: 280.796 bits (717), Expect = 6.720e-75
Identity = 146/276 (52.90%), Postives = 188/276 (68.12%), Query Frame = 3
Query:   18 LTLVHILEATNNFCKTNIIGDGGFGTVYKAALPDGKTVAVKKLSQAKTQGHREFTAEMETLGKVKHQNLVPLLGYCSFGEEKLLVYEYMVNGSLDLWLRNRTGSLEVLGWDKRYKIACGAARGLAFLHHGFTPHIIHRDIKASNILLNEEFEAKVADFGLARLISACETHVSTDIAGTFGYIPPEYGQSGRSTTRGDVYSFGVILLELVTGKEPTGPEFKDIEGGNLVGWVFQKMKKGQAADVLDPTVLTADSKPMMLKMLRIAGDCLSDNPAMRP 845
            L++  +L++TNNF + NIIG GGFG VYKA  PDG   AVK+LS    Q  REF AE+E L + +H+NLV L GYC  G ++LL+Y +M NGSLD WL  R      L WD R KIA GAARGLA+LH    P++IHRD+K+SNILL+E+FEA +ADFGLARL+   +THV+TD+ GT GYIPPEY QS  +T RGDVYSFGV+LLELVTG+ P     K     +LV  VFQ   + + A+++D T+    ++  +L+ML IA  C+   P  RP
Sbjct:  742 LSVEELLKSTNNFSQANIIGCGGFGLVYKANFPDGSKAAVKRLSGDCGQMEREFQAEVEALSRAEHKNLVSLQGYCKHGNDRLLIYSFMENGSLDYWLHERVDGNMTLIWDVRLKIAQGAARGLAYLHKVCEPNVIHRDVKSSNILLDEKFEAHLADFGLARLLRPYDTHVTTDLVGTLGYIPPEYSQSLIATCRGDVYSFGVVLLELVTGRRPV-EVCKGKSCRDLVSRVFQMKAEKREAELIDTTIRENVNERTVLEMLEIACKCIDHEPRRRP 1016          
The following BLAST results are available for this feature:
BLAST of FC929081 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
EXS_ARATH5.610e-12276.06Leucine-rich repeat receptor protein kinase EXS OS... [more]
BRL3_ARATH1.181e-8757.84Receptor-like protein kinase BRI1-like 3 OS=Arabid... [more]
BRL1_ARATH4.960e-8657.09Serine/threonine-protein kinase BRI1-like 1 OS=Ara... [more]
BRI1_SOLPE1.034e-8356.79Systemin receptor SR160 OS=Solanum peruvianum PE=1... [more]
BRI1_SOLLC2.304e-8356.79Brassinosteroid LRR receptor kinase OS=Solanum lyc... [more]
BRI1_ARATH9.681e-8255.56Protein BRASSINOSTEROID INSENSITIVE 1 OS=Arabidops... [more]
BRL2_ARATH3.443e-7952.33Serine/threonine-protein kinase BRI1-like 2 OS=Ara... [more]
PSKR1_ARATH1.709e-7854.04Phytosulfokine receptor 1 OS=Arabidopsis thaliana ... [more]
PSKR1_DAUCA3.223e-7753.07Phytosulfokine receptor 1 OS=Daucus carota GN=PSKR... [more]
PSKR2_ARATH6.720e-7552.90Phytosulfokine receptor 2 OS=Arabidopsis thaliana ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAH3CB10RM1 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH3CB10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929081 ID=FC929081|Name=FC929081|organism=Citrus clementina|type=EST|length=854bp
AGCAACCTCTCATGAGACTAACTTTGGTTCATATTCTTGAAGCCACAAAC
AACTTCTGCAAGACAAATATTATTGGAGATGGTGGCTTTGGAACTGTATA
CAAAGCCGCTTTGCCTGATGGGAAAACAGTTGCTGTTAAGAAGTTAAGCC
AGGCTAAAACACAGGGGCACCGTGAATTCACTGCTGAAATGGAAACTCTG
GGCAAGGTGAAGCACCAGAATCTTGTGCCGCTGCTTGGTTACTGCTCATT
TGGTGAGGAGAAGCTTCTTGTTTATGAATACATGGTAAATGGAAGCTTGG
ATCTGTGGTTAAGAAATCGGACGGGTTCTCTTGAAGTTCTTGGCTGGGAT
AAACGCTACAAAATTGCATGTGGCGCTGCTCGTGGGCTAGCTTTTCTTCA
TCACGGCTTCACCCCACATATCATTCATCGCGATATCAAAGCAAGCAACA
TCTTACTCAATGAAGAGTTTGAAGCCAAAGTTGCAGACTTTGGGCTTGCT
AGACTGATCAGTGCATGCGAGACACATGTTAGCACTGATATTGCAGGCAC
ATTTGGTTACATTCCCCCCGAGTATGGGCAGAGTGGGAGATCTACCACAA
GGGGTGATGTATACAGCTTTGGTGTAATCTTGCTGGAATTGGTGACTGGA
AAAGAGCCTACGGGGCCCGAATTCAAAGATATAGAAGGTGGGAACTTGGT
CGGTTGGGTGTTTCAGAAGATGAAGAAGGGACAGGCTGCTGATGTTCTAG
ATCCTACAGTCCTTACTGCAGATTCAAAGCCCATGATGCTTAAAATGCTC
CGGATTGCTGGTGATTGCCTCTCTGATAACCCTGCTATGAGGCCTACCAT
GCTG
back to top