FC929090

Overview
NameFC929090
Unique NameFC929090
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length748
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig982 contig Ccv1_Contig982:17..764. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929090 vs. ExPASy Swiss-Prot
Match: NAC78_ARATH (NAC domain-containing protein 78 OS=Arabidopsis thaliana GN=NAC078 PE=2 SV=2)

HSP 1 Score: 84.7297 bits (208), Expect = 5.685e-16
Identity = 53/154 (34.42%), Postives = 77/154 (50.00%), Query Frame = 3
Query:  132 SEMESGYKFQPSDXXXXXXXXXXXX-NPHFSHHPIKDIDHICSLEPWDLPTESKTESEDQVFYFFYEPRYKYRNSNRVDRRTEAGQWKITSKDSQIEAGNGLTGTKKFLTFY-CRGPDSKVPVKTDWVVHEYHAKDDPRY-----EKEFVLCCI 572
            + +  G++F P+D             N  F    I   D I   EPWDLP +SK +S D  +YFF     KY N ++ +R TE G WK T KD +I  G+ + G KK L ++  R P  +   +T+WV+HEY   D+        ++ +VLC I
Sbjct:    7 TSLAPGFRFHPTDEELVRYYLKRKVCNKPFKFDAISVTD-IYKSEPWDLPDKSKLKSRDLEWYFFSMLDKKYSNGSKTNRATEKGYWKTTGKDREIRNGSRVVGMKKTLVYHKGRAPRGE---RTNWVMHEYRLSDEDLKKAGVPQEAYVLCRI 156          
BLAST of FC929090 vs. ExPASy Swiss-Prot
Match: NAC4_ARATH (NAC domain-containing protein 4 OS=Arabidopsis thaliana GN=NAC004 PE=2 SV=2)

HSP 1 Score: 79.337 bits (194), Expect = 2.388e-14
Identity = 49/133 (36.84%), Postives = 65/133 (48.87%), Query Frame = 3
Query:  147 GYKFQPSDXXXXXXXXXXXXNPHFSHHP---IKDIDHICSLEPWDLPTESKTESEDQVFYFFYEPRYKYRNSNRVDRRTEAGQWKITSKDSQIEAGNG---LTGTKKFLTFYCRGPDSKVPVKTDWVVHEYHA 527
            G++F+P+D                + H    I  +D ICS EPWDLP++S  +S D V+YFF     KY   ++  RRT +G WK T K   +    G     G K+ L F  R        KTDWV+HEYHA
Sbjct:    6 GFRFRPNDEEIVDHYLRPKNLDSDTSHVDEVISTVD-ICSFEPWDLPSKSMIKSRDGVWYFFSVKEMKYNRGDQQRRRTNSGFWKKTGKTMTVMRKRGNREKIGEKRVLVFKNRDGS-----KTDWVMHEYHA 132          
BLAST of FC929090 vs. ExPASy Swiss-Prot
Match: NAC74_ORYSJ (NAC domain-containing protein 74 OS=Oryza sativa subsp. japonica GN=NAC74 PE=2 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 3.119e-14
Identity = 46/121 (38.02%), Postives = 66/121 (54.55%), Query Frame = 3
Query:  231 IKDIDHICSLEPWDLPTESKTESEDQVFYFFYEPRYKYRNSNRVDRRTEAGQWKITSKDSQIEAGNGLTGTKKFLTFY-CRGPDSKVPVKTDWVVHEYHAKDD-----PRYEKEFVLCCIT 575
            I ++D I   EPWDLP +    ++D  ++FF     KY N +R +R T AG WK T KD  I+ G    GTKK L F+  R P  +   +T+W++HEY+  +      P  +  +VLC IT
Sbjct:   41 IPEVD-IYKHEPWDLPAKCDVPTQDNKWHFFAARDRKYPNGSRSNRATVAGYWKSTGKDRAIKMGKQTIGTKKTLVFHEGRPPTGR---RTEWIMHEYYIDERECQACPDMKDAYVLCRIT 157          
BLAST of FC929090 vs. ExPASy Swiss-Prot
Match: NAC5_ARATH (NAC domain-containing protein 5 OS=Arabidopsis thaliana GN=NAC005 PE=2 SV=2)

HSP 1 Score: 77.411 bits (189), Expect = 9.076e-14
Identity = 49/147 (33.33%), Postives = 69/147 (46.94%), Query Frame = 3
Query:  147 GYKFQPSDXXXXXXXXXXXXNPHFSHHP---IKDIDHICSLEPWDLPTESKTESEDQVFYFFYEPRYKYRNSNRVDRRTEAGQWKITSKDSQIEAGNG---LTGTKKFLTFYCRGPDSKVPVKTDWVVHEYHAK-DDPRYEKEFVLC 566
            G++F+P+D                + H    I  +D ICS +PWDLP+ S+ ++ DQV+YFF     KY   +R  R+T++G WK T     I    G     G K+ L F   G       K+DW +HEYHA    P     + LC
Sbjct:    6 GFRFRPTDGEIVDIYLRPKNLESNTSHVDEVISTVD-ICSFDPWDLPSHSRMKTRDQVWYFFGRKENKYGKGDRQIRKTKSGFWKKTGVTMDIMRKTGDREKIGEKRVLVFKNHGGS-----KSDWAMHEYHATFSSPNQIMTYTLC 146          
BLAST of FC929090 vs. ExPASy Swiss-Prot
Match: NAC7_ARATH (NAC domain-containing protein 7 OS=Arabidopsis thaliana GN=NAC007 PE=2 SV=2)

HSP 1 Score: 76.2554 bits (186), Expect = 2.022e-13
Identity = 51/151 (33.77%), Postives = 74/151 (49.01%), Query Frame = 3
Query:  132 SEMESGYKFQPSDXXXXXXXXXXXX-NPHFSHHPIKDIDHICSLEPWDLPTESKTESEDQV-FYFFYEPRYKYRNSNRVDRRTEAGQWKITSKDSQIEAGNGLTGTKKFLTFY-CRGPDSKVPVKTDWVVHEYHAKDDPR---YEKEFVLC 566
            S +  G++F P+D             +       IKDID +  +EPWDL    K   E+Q  +YFF     KY    R +R T+AG WK T +D  I   + L G +K L FY  R P+ +   K+DW++HEY  + D      E+ +V+C
Sbjct:    5 SHVPPGFRFHPTDEELVDYYLRKKVASKRIEIDFIKDID-LYKIEPWDLQELCKIGHEEQSDWYFFSHKDKKYPTGTRTNRATKAGFWKATGRDKAIYLRHSLIGMRKTLVFYKGRAPNGQ---KSDWIMHEYRLETDENGTPQEEGWVVC 151          
BLAST of FC929090 vs. ExPASy Swiss-Prot
Match: NAC69_ARATH (NAC domain-containing protein 69 OS=Arabidopsis thaliana GN=NAC69 PE=2 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 2.641e-13
Identity = 45/140 (32.14%), Postives = 69/140 (49.29%), Query Frame = 3
Query:  246 HICSLEPWDLPTESKTESEDQVFYFFYEPRYKYRNSNRVDRRTEAGQWKITSKDSQIE---AGNGLTGTKKFLTFYCRGPDSKVP--VKTDWVVHEYHAKDDPRYEKEFVLCCITNGEASAYVDDGSETNTADNDAWVEE 650
            +ICS +P  LP+ SK +S+D V+YFF    Y         R T +G WK T  D +I+      G  G KK L +Y    + +VP  V T WV+HEYH    P+ ++ +V+C +        V  G   ++  + + V +
Sbjct:   41 NICSYDPIYLPSLSKIKSDDPVWYFFCPKEYTSAKKKVTKRTTSSGYWKATGVDRKIKDKRGNRGEIGIKKTLVYY----EGRVPKGVWTPWVMHEYHITCLPQDQRNYVICQVMYKGEDGDVPSGGNNSSEPSQSLVSD 176          
BLAST of FC929090 vs. ExPASy Swiss-Prot
Match: NAC1_ARATH (NAC domain-containing protein 1 OS=Arabidopsis thaliana GN=NAC001 PE=2 SV=2)

HSP 1 Score: 74.7146 bits (182), Expect = 5.883e-13
Identity = 41/117 (35.04%), Postives = 64/117 (54.70%), Query Frame = 3
Query:  246 HICSLEPWDLPTESKTESEDQVFYFFYEPRYKYRNSNRVDRRTEAGQWKITSKDSQI--------EAGNGLTGTKKFLTFYCRGPDSKVPVKT--DWVVHEYHAKDDPRYEKEFVLC 566
            +ICS +PW+L  +SK +S D ++YFF   R +    NR  R T +G+WK+T +  ++        E   G  G K+ L F     D + P KT  DWV+HE+H    P +++ +V+C
Sbjct:   41 NICSYDPWNLRFQSKYKSRDAMWYFF--SRRENNKGNRQSRTTVSGKWKLTGESVEVKDQWGFCSEGFRGKIGHKRVLVFL----DGRYPDKTKSDWVIHEFHYDLLPEHQRTYVIC 151          
BLAST of FC929090 vs. ExPASy Swiss-Prot
Match: NAC3_ARATH (NAC domain-containing protein 3 OS=Arabidopsis thaliana GN=NAC003 PE=2 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 1.311e-12
Identity = 42/146 (28.77%), Postives = 67/146 (45.89%), Query Frame = 3
Query:  135 EMESGYKFQPSDXXXXXXXXXXXXNPHFSHHPIKDIDHI--CSLEPWDLPTESKTESEDQVFYFFYEPRYKYRNSNRVDRRTEAGQWKITSKDSQIEAGNGLTGTKKFLTFYCRGPDSKVPVKTDWVVHEYHAKDDPRYEKEFVLC 566
            E   G +F P+D            +   + H  + I+ +  C L+PW+LP +S+ + +D  + FF     KY   ++  R+T++G WK T +   I       G KK L FY     +    K+DWV+HEYH     +    + LC
Sbjct:    2 ETPVGLRFCPTDEEIVVDYLWPKNSDRDTSHVDRFINTVPVCRLDPWELPCQSRIKLKDVAWCFFRPKENKYGRGDQQMRKTKSGFWKSTGRPKPIMRNRQQIGEKKILMFY-----TSKESKSDWVIHEYHGFSHNQMMMTYTLC 142          
BLAST of FC929090 vs. ExPASy Swiss-Prot
Match: NAC29_ARATH (NAC domain-containing protein 29 OS=Arabidopsis thaliana GN=NAC029 PE=2 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.712e-12
Identity = 45/123 (36.59%), Postives = 59/123 (47.97%), Query Frame = 3
Query:  231 IKDIDHICSLEPWDLPTESKTESEDQVFYFFYEPRYKYRNSNRVDRRTEAGQWKITSKDSQIEAGNGLTGTKKFLTFYCRGPDSKVPVKTDWVVHEYHAKDDPRYE---------KEFVLCCI 572
            I ++D I   +PW LP   KTE  +  +YFF     KY N  R +R   +G WK T  D  I +G+   G KK L FY   P     +KTDW++HEY   D  +            E+VLC I
Sbjct:   41 IPEVD-IYKFDPWQLP--EKTEFGENEWYFFSPRERKYPNGVRPNRAAVSGYWKATGTDKAIHSGSSNVGVKKALVFYKGRPPK--GIKTDWIMHEYRLHDSRKASTKRNGSMRLDEWVLCRI 158          
BLAST of FC929090 vs. ExPASy Swiss-Prot
Match: NAC54_ARATH (Protein CUP-SHAPED COTYLEDON 1 OS=Arabidopsis thaliana GN=NAC054 PE=1 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 2.236e-12
Identity = 56/166 (33.73%), Postives = 80/166 (48.19%), Query Frame = 3
Query:  132 SEMESGYKFQPSDXXXXXXXXXXXX-NPHFSHHPIKDIDHICSLEPWDLPTESKTESEDQVFYFFYEPRYKYRNSNRVDRRTEAGQWKITSKDSQIEAG--NGLTGTKKFLTFY-CRGPDSKVPVKTDWVVHEYHAKDDPRY-------EKEFVLC--CITNGEAS 590
            S M  G++F P+D             + +FS   I  +D +   EPW+LP ++K   ++  +YFF     KY    R +R TEAG WK T KD +I++     L G KK L FY  R P  +   K+ WV+HEY       Y       + E+VLC  C+ +G  S
Sbjct:   18 SLMPPGFRFHPTDEELITYYLLKKVLDSNFSCAAISQVD-LNKSEPWELPEKAKMGEKE--WYFFTLRDRKYPTGLRTNRATEAGYWKATGKDREIKSSKTKSLLGMKKTLVFYKGRAPKGE---KSCWVMHEYRLDGKFSYHYISSSAKDEWVLCKVCLKSGVVS 177          
The following BLAST results are available for this feature:
BLAST of FC929090 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 19
Match NameE-valueIdentityDescription
NAC78_ARATH5.685e-1634.42NAC domain-containing protein 78 OS=Arabidopsis th... [more]
NAC4_ARATH2.388e-1436.84NAC domain-containing protein 4 OS=Arabidopsis tha... [more]
NAC74_ORYSJ3.119e-1438.02NAC domain-containing protein 74 OS=Oryza sativa s... [more]
NAC5_ARATH9.076e-1433.33NAC domain-containing protein 5 OS=Arabidopsis tha... [more]
NAC7_ARATH2.022e-1333.77NAC domain-containing protein 7 OS=Arabidopsis tha... [more]
NAC69_ARATH2.641e-1332.14NAC domain-containing protein 69 OS=Arabidopsis th... [more]
NAC1_ARATH5.883e-1335.04NAC domain-containing protein 1 OS=Arabidopsis tha... [more]
NAC3_ARATH1.311e-1228.77NAC domain-containing protein 3 OS=Arabidopsis tha... [more]
NAC29_ARATH1.712e-1236.59NAC domain-containing protein 29 OS=Arabidopsis th... [more]
NAC54_ARATH2.236e-1233.73Protein CUP-SHAPED COTYLEDON 1 OS=Arabidopsis thal... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAH1DF07RM2 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH1DF07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929090 ID=FC929090|Name=FC929090|organism=Citrus clementina|type=EST|length=748bp
ATCACACACTCACACTCACACTCACTCTTTGGGTCTCCACTGTAACTGTT
CTGAATTAGTACCAGTCTTGGGGGGTTTCATCAGATCACTACCAGCAATT
GAAGAAGTGGTTATTGTAAAAAAAAAAAAAATCTGAAATGGAGAGTGGGT
ATAAATTCCAGCCATCTGATGAACTAATCCTCCGTCTTCTCAAGGAGAAG
AGGCTTAACCCCCATTTCTCACATCATCCTATCAAGGATATTGATCATAT
CTGCAGCCTTGAGCCATGGGACTTACCAACGGAATCAAAAACTGAGTCTG
AGGATCAAGTTTTTTACTTTTTCTATGAACCTCGTTACAAGTACAGGAAC
AGTAACCGGGTCGACAGAAGAACAGAAGCAGGGCAATGGAAAATTACCAG
TAAAGATTCCCAAATCGAAGCTGGAAACGGCCTTACCGGTACCAAAAAGT
TCTTGACTTTCTACTGCCGTGGTCCTGATTCTAAGGTACCAGTTAAGACC
GACTGGGTTGTGCATGAGTACCATGCCAAGGACGACCCCCGTTATGAGAA
GGAATTTGTTCTGTGTTGCATAACAAATGGAGAAGCTTCAGCTTATGTAG
ATGATGGCAGTGAGACAAACACTGCTGACAACGATGCATGGGTGGAAGAA
CGTTCTGTAATCTTAAGTAGCTTGTAAACAATTATAAAATCCTCTTAGGA
GGAAAGTACTGTAATTTTAANGAGGCATGCAAACAATTATGAAATCCT
back to top