FC929101

Overview
NameFC929101
Unique NameFC929101
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length864
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig5805 contig Ccv1_Contig5805:798..1661. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929101 vs. ExPASy Swiss-Prot
Match: ARR1_ARATH (Two-component response regulator ARR1 OS=Arabidopsis thaliana GN=ARR1 PE=1 SV=2)

HSP 1 Score: 68.5514 bits (166), Expect = 5.366e-11
Identity = 36/70 (51.43%), Postives = 46/70 (65.71%), Query Frame = 1
Query:  205 RKQRRSWSPELHRRFLHALQQLGGSHAATPKQIRELMNVDGLTNDEVKSHLQKYRLHTRRPSPAMHNGGN 414
            +K R  WS ELH++F+ A+ QLG    A PK+I ELMNV GLT + V SHLQKYR++ RR      + GN
Sbjct:  236 KKPRVVWSVELHQQFVAAVNQLG-VEKAVPKKILELMNVPGLTRENVASHLQKYRIYLRRLGGVSQHQGN 304          
The following BLAST results are available for this feature:
BLAST of FC929101 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
ARR1_ARATH5.366e-1151.43Two-component response regulator ARR1 OS=Arabidops... [more]
back to top
Properties
Property NameValue
Genbank descriptionKN0AAH3CC07RM1 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH3CC07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929101 ID=FC929101|Name=FC929101|organism=Citrus clementina|type=EST|length=864bp
GTGGTTGAAGTGAAGAGAAATGGAAGTGGAGGTGCATTTCAGCCATTTCA
CAGAGAAAAATGTGGGGAAAAGAAGGACCAGCAACAAAGACTGGGAAAAG
TTAATACTCCGGTCCCAACGGCTGCTGCTAGTTCCACAACGGACACTGCG
GTTGGTAAAGGTGAAAAAAATGATAAAGATAAAGATAAAGAGGGCCAGCC
TCAAAGAAAGCAAAGGCGCTCTTGGTCGCCTGAATTGCATAGACGGTTCT
TGCATGCTCTTCAACAACTCGGTGGCTCACATGCTGCTACGCCTAAGCAA
ATTAGGGAGCTAATGAATGTTGATGGGCTTACTAATGATGAAGTCAAGAG
CCATCTACAGAAATATCGTCTGCATACAAGGAGACCAAGTCCGGCAATGC
ACAACGGTGGCAACCCACAAGCGCCCCAATTTGTGGTGGTCGGAGGCATT
TGGGTGCAAGCGCCTGACTATGCAGCAGTTGCTGCCAAAGCCCCAGGGGA
AGCAGGCTCTATTGCCACAAGCAACGGAATCTATGCACCGGTAGCTGCAC
CACCGCCTGCAGTACCTCAATCTTCAGCATCAGTAGTGCAAATATCTCAA
CAGACACAATCCGAGCACTTACAATCAGAAGAAAGGGGCAGTCATAGTGA
CGGCGGCCATCATGCTAATTCTCCGGCTACATCTTCCTCTACGCATACCA
CCACAACTTCCCCTGTGTTCTAGCATCCGTAGAAACAGAATGGTGTAAAA
TTTTTGTAACAAAGCTTGCTAGTAGAAATTTCTATATCACATGACAATTT
TTCTTCTTGTTTTTGGAGTGTAAAACTTTGATAGAGTTATAGCTGGATAC
ATTGCAAAATGACT
back to top