FC929105

Overview
NameFC929105
Unique NameFC929105
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length858
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig952 contig Ccv1_Contig952:43..900. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929105 vs. ExPASy Swiss-Prot
Match: INO1_CITPA (Inositol-3-phosphate synthase OS=Citrus paradisi PE=3 SV=1)

HSP 1 Score: 420.239 bits (1079), Expect = 7.139e-117
Identity = 205/208 (98.56%), Postives = 206/208 (99.04%), Query Frame = 2
Query:  233 MFIENFKVESPNVKYTDNEIHSVYDYETTELVHENRNGTYQWIVKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKDTVQQANYFGSLTQASAIRVGSYNGEEIYAPFKSILPMVNPDDIVFGGWDISDMNLADAMARARVFDIDLQKQLRPYMESMVPLPGIYDLDFIAANQGSRANNVIKGTKKEQMLQ 856
            MFIENFKVESPNVKYTD+EIHSVYDYETTELVHENRNGTYQWIVKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGI WATKDTVQQANYFGSLTQASAIRVGSYNGEEIYAPFKSILPMVNPDDIVFGGWDISDMNLADAMARARVFDIDLQKQLRPYMESMVPLPGIYD DFIAANQGSRANNVIKGTKKEQMLQ
Sbjct:    1 MFIENFKVESPNVKYTDHEIHSVYDYETTELVHENRNGTYQWIVKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGICWATKDTVQQANYFGSLTQASAIRVGSYNGEEIYAPFKSILPMVNPDDIVFGGWDISDMNLADAMARARVFDIDLQKQLRPYMESMVPLPGIYDPDFIAANQGSRANNVIKGTKKEQMLQ 208          
BLAST of FC929105 vs. ExPASy Swiss-Prot
Match: INO1_NICPA (Inositol-3-phosphate synthase OS=Nicotiana paniculata GN=INPS1 PE=2 SV=1)

HSP 1 Score: 400.593 bits (1028), Expect = 5.853e-111
Identity = 192/208 (92.31%), Postives = 202/208 (97.12%), Query Frame = 2
Query:  233 MFIENFKVESPNVKYTDNEIHSVYDYETTELVHENRNGTYQWIVKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKDTVQQANYFGSLTQASAIRVGSYNGEEIYAPFKSILPMVNPDDIVFGGWDISDMNLADAMARARVFDIDLQKQLRPYMESMVPLPGIYDLDFIAANQGSRANNVIKGTKKEQMLQ 856
            MFIENFKVESPNVKYT++EIHSVYDY+TTELVH+ +NGTYQW VKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKD VQQANYFGSLTQAS IRVGS+NGEEIYAPFKS+LPMVNPDD+VFGGWDISDMNLADAMARA+VFDIDLQKQLRPYMESMVPLPGIYD DFIAANQGSRANNVIKGTKKEQ+ Q
Sbjct:    1 MFIENFKVESPNVKYTESEIHSVYDYQTTELVHDEKNGTYQWTVKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKDKVQQANYFGSLTQASTIRVGSFNGEEIYAPFKSLLPMVNPDDVVFGGWDISDMNLADAMARAKVFDIDLQKQLRPYMESMVPLPGIYDPDFIAANQGSRANNVIKGTKKEQIDQ 208          
BLAST of FC929105 vs. ExPASy Swiss-Prot
Match: INO1_TOBAC (Inositol-3-phosphate synthase OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 399.053 bits (1024), Expect = 1.703e-110
Identity = 192/208 (92.31%), Postives = 201/208 (96.63%), Query Frame = 2
Query:  233 MFIENFKVESPNVKYTDNEIHSVYDYETTELVHENRNGTYQWIVKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKDTVQQANYFGSLTQASAIRVGSYNGEEIYAPFKSILPMVNPDDIVFGGWDISDMNLADAMARARVFDIDLQKQLRPYMESMVPLPGIYDLDFIAANQGSRANNVIKGTKKEQMLQ 856
            MFIENFKVESPNVKYT++EIHSVYDY+TTELVHE +NGTYQW VKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKD VQQANYFGSLTQAS IRVGS+NGEEIYAPFKS+LPMVNPDD+VFGGWDIS MNLADAMARA+VFDIDLQKQLRPYMESMVPLPGIYD DFIAANQGSRANNVIKGTKKEQ+ Q
Sbjct:    1 MFIENFKVESPNVKYTESEIHSVYDYQTTELVHEEKNGTYQWTVKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKDKVQQANYFGSLTQASTIRVGSFNGEEIYAPFKSLLPMVNPDDVVFGGWDISGMNLADAMARAKVFDIDLQKQLRPYMESMVPLPGIYDPDFIAANQGSRANNVIKGTKKEQIDQ 208          
BLAST of FC929105 vs. ExPASy Swiss-Prot
Match: INO1_WHEAT (Inositol-3-phosphate synthase OS=Triticum aestivum GN=MIPS PE=2 SV=1)

HSP 1 Score: 394.43 bits (1012), Expect = 4.195e-109
Identity = 189/208 (90.87%), Postives = 200/208 (96.15%), Query Frame = 2
Query:  233 MFIENFKVESPNVKYTDNEIHSVYDYETTELVHENRNGTYQWIVKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKDTVQQANYFGSLTQASAIRVGSYNGEEIYAPFKSILPMVNPDDIVFGGWDISDMNLADAMARARVFDIDLQKQLRPYMESMVPLPGIYDLDFIAANQGSRANNVIKGTKKEQMLQ 856
            MFIE+FKVESPNVKYT+NEIHSVYDYETTE+VHENRNGTYQW+VKPKTVKY+FKTD  VPKLGVMLVGWGGNNGSTLT GVIAN+EGISWATKD VQQANYFGSLTQAS+IRVGSYNGEEIYAPFKS+LPMVNPDD+VFGGWDISDMNLADAMARARV DIDLQKQLRPYME MVPLPGIYD DFIAANQGSRAN+VIKGTKKEQ+ Q
Sbjct:    1 MFIESFKVESPNVKYTENEIHSVYDYETTEVVHENRNGTYQWVVKPKTVKYDFKTDTRVPKLGVMLVGWGGNNGSTLTAGVIANKEGISWATKDKVQQANYFGSLTQASSIRVGSYNGEEIYAPFKSLLPMVNPDDVVFGGWDISDMNLADAMARARVLDIDLQKQLRPYMEHMVPLPGIYDPDFIAANQGSRANSVIKGTKKEQVDQ 208          
BLAST of FC929105 vs. ExPASy Swiss-Prot
Match: INO1_SESIN (Inositol-3-phosphate synthase OS=Sesamum indicum PE=2 SV=1)

HSP 1 Score: 394.045 bits (1011), Expect = 5.479e-109
Identity = 189/208 (90.87%), Postives = 200/208 (96.15%), Query Frame = 2
Query:  233 MFIENFKVESPNVKYTDNEIHSVYDYETTELVHENRNGTYQWIVKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKDTVQQANYFGSLTQASAIRVGSYNGEEIYAPFKSILPMVNPDDIVFGGWDISDMNLADAMARARVFDIDLQKQLRPYMESMVPLPGIYDLDFIAANQGSRANNVIKGTKKEQMLQ 856
            MFIE+FKVESPNVKYT+ EIHSVY+YETTELVHE+RNGTYQWIVKPKTVKYEFKTD HVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKD VQQANYFGSLTQAS+IRVGS+NGEEIYAPFKS+LPMVNPDD+VFGGWDIS+MNLADAM RA+V DIDLQKQLRPYME MVPLPGIYD DFIAANQGSRANNVIKGTKKEQ+ Q
Sbjct:    1 MFIESFKVESPNVKYTEGEIHSVYNYETTELVHESRNGTYQWIVKPKTVKYEFKTDTHVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKDKVQQANYFGSLTQASSIRVGSFNGEEIYAPFKSLLPMVNPDDVVFGGWDISNMNLADAMGRAKVLDIDLQKQLRPYMEHMVPLPGIYDPDFIAANQGSRANNVIKGTKKEQVQQ 208          
BLAST of FC929105 vs. ExPASy Swiss-Prot
Match: INO2_ARATH (Inositol-3-phosphate synthase isozyme 2 OS=Arabidopsis thaliana GN=At2g22240 PE=2 SV=2)

HSP 1 Score: 390.193 bits (1001), Expect = 7.911e-108
Identity = 185/206 (89.81%), Postives = 200/206 (97.09%), Query Frame = 2
Query:  233 MFIENFKVESPNVKYTDNEIHSVYDYETTELVHENRNGTYQWIVKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKDTVQQANYFGSLTQASAIRVGSYNGEEIYAPFKSILPMVNPDDIVFGGWDISDMNLADAMARARVFDIDLQKQLRPYMESMVPLPGIYDLDFIAANQGSRANNVIKGTKKEQM 850
            MFIE+FKVESPNVKYT+NEI+SVYDYETTE+VHENRNGTYQW+VKPKTVKY+FKTD  VPKLGVMLVGWGGNNGSTLT GVIAN+EGISWATKD VQQANYFGSLTQAS+IRVGSYNGEEIYAPFKS+LPMVNP+D+VFGGWDISDMNLADAMARARV DIDLQKQLRPYME+M+PLPGIYD DFIAANQGSRAN+VIKGTKKEQ+
Sbjct:    1 MFIESFKVESPNVKYTENEINSVYDYETTEVVHENRNGTYQWVVKPKTVKYDFKTDTRVPKLGVMLVGWGGNNGSTLTAGVIANKEGISWATKDKVQQANYFGSLTQASSIRVGSYNGEEIYAPFKSLLPMVNPEDVVFGGWDISDMNLADAMARARVLDIDLQKQLRPYMENMIPLPGIYDPDFIAANQGSRANSVIKGTKKEQV 206          
BLAST of FC929105 vs. ExPASy Swiss-Prot
Match: INO3_ARATH (Probable inositol-3-phosphate synthase isozyme 3 OS=Arabidopsis thaliana GN=At5g10170 PE=2 SV=1)

HSP 1 Score: 382.489 bits (981), Expect = 1.650e-105
Identity = 181/208 (87.02%), Postives = 199/208 (95.67%), Query Frame = 2
Query:  233 MFIENFKVESPNVKYTDNEIHSVYDYETTELVHENRNGTYQWIVKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKDTVQQANYFGSLTQASAIRVGSYNGEEIYAPFKSILPMVNPDDIVFGGWDISDMNLADAMARARVFDIDLQKQLRPYMESMVPLPGIYDLDFIAANQGSRANNVIKGTKKEQMLQ 856
            MFIE+FKVESPNVKYT+NEIHSVYDY+TTELVHEN+NG +QW VKPKTVKYEFKTD HVPKLGVMLVGWGGNNGSTLT GVIANREGISWATK+ VQQANYFGSLTQAS+IRVGS+NGEEIYAPFKS+LPMVNP++IVFGGWDISDMNLADAMARA+V DIDLQKQ+RP+ME MVPLPGI+D DFIAANQGSRAN+VIKGTKK+Q+ Q
Sbjct:    1 MFIESFKVESPNVKYTENEIHSVYDYQTTELVHENKNGAFQWTVKPKTVKYEFKTDTHVPKLGVMLVGWGGNNGSTLTAGVIANREGISWATKEKVQQANYFGSLTQASSIRVGSFNGEEIYAPFKSLLPMVNPEEIVFGGWDISDMNLADAMARAKVLDIDLQKQMRPFMEHMVPLPGIFDPDFIAANQGSRANHVIKGTKKQQLEQ 208          
BLAST of FC929105 vs. ExPASy Swiss-Prot
Match: INO1_BRANA (Inositol-3-phosphate synthase OS=Brassica napus PE=2 SV=2)

HSP 1 Score: 382.489 bits (981), Expect = 1.650e-105
Identity = 182/208 (87.50%), Postives = 197/208 (94.71%), Query Frame = 2
Query:  233 MFIENFKVESPNVKYTDNEIHSVYDYETTELVHENRNGTYQWIVKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKDTVQQANYFGSLTQASAIRVGSYNGEEIYAPFKSILPMVNPDDIVFGGWDISDMNLADAMARARVFDIDLQKQLRPYMESMVPLPGIYDLDFIAANQGSRANNVIKGTKKEQMLQ 856
            MFIE+FKVESPNVKYT+NEIHSVYDYETTE+VHEN NG YQWIVKPK VKY+FKTD  VPKLGVMLVGWGGNNGSTLT GVIAN+EGISWATKD VQQANYFGSLTQAS+IRVGS+NGEE+YAPFKS++PMVNPDD+VFGGWDISDMNLADAM RA+V DIDLQKQLRPYME++VPLPGIYD DFIAANQGSRANNVIKGTKKEQ+ Q
Sbjct:    1 MFIESFKVESPNVKYTENEIHSVYDYETTEVVHENVNGAYQWIVKPKVVKYDFKTDTRVPKLGVMLVGWGGNNGSTLTAGVIANKEGISWATKDKVQQANYFGSLTQASSIRVGSFNGEEMYAPFKSLVPMVNPDDVVFGGWDISDMNLADAMGRAKVLDIDLQKQLRPYMENIVPLPGIYDPDFIAANQGSRANNVIKGTKKEQVDQ 208          
BLAST of FC929105 vs. ExPASy Swiss-Prot
Match: INO1_MESCR (Inositol-3-phosphate synthase OS=Mesembryanthemum crystallinum PE=2 SV=1)

HSP 1 Score: 381.333 bits (978), Expect = 3.675e-105
Identity = 185/208 (88.94%), Postives = 196/208 (94.23%), Query Frame = 2
Query:  233 MFIENFKVESPNVKYTDNEIHSVYDYETTELVHENRN--GTYQWIVKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKDTVQQANYFGSLTQASAIRVGSYNGEEIYAPFKSILPMVNPDDIVFGGWDISDMNLADAMARARVFDIDLQKQLRPYMESMVPLPGIYDLDFIAANQGSRANNVIKGTKKEQM 850
            MFIE+FKVESPNVKYT+NEI SVY+Y+TTELVHENR   G YQWIVKPKTV+Y FKTD  VPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKD +QQANYFGSLTQAS+IRVGS+NGEEIYAPFKS+LPMVNPDD+VFGGWDISDMNLADAM RARVFDIDLQKQLRPYME MVPLPGIYD DFIAANQGSRANNVIKGTKKEQ+
Sbjct:    1 MFIESFKVESPNVKYTENEIESVYNYDTTELVHENRKDAGGYQWIVKPKTVQYHFKTDTRVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKDKIQQANYFGSLTQASSIRVGSFNGEEIYAPFKSLLPMVNPDDVVFGGWDISDMNLADAMTRARVFDIDLQKQLRPYMEHMVPLPGIYDPDFIAANQGSRANNVIKGTKKEQV 208          
BLAST of FC929105 vs. ExPASy Swiss-Prot
Match: INO1_PHAVU (Inositol-3-phosphate synthase OS=Phaseolus vulgaris PE=2 SV=1)

HSP 1 Score: 377.481 bits (968), Expect = 5.306e-104
Identity = 183/207 (88.41%), Postives = 198/207 (95.65%), Query Frame = 2
Query:  233 MFIENFKVESPNVKYTDNEIHSVYDYETTELVHENR-NGTYQWIVKPKTVKYEFKTDVHVPKLGVMLVGWGGNNGSTLTGGVIANREGISWATKDTVQQANYFGSLTQASAIRVGSYNGEEIYAPFKSILPMVNPDDIVFGGWDISDMNLADAMARARVFDIDLQKQLRPYMESMVPLPGIYDLDFIAANQGSRANNVIKGTKKEQM 850
            MFIE+FKVESPNVKYT+NEIHSVYDYETTE+VHE   NGTYQWIVKPKTVKY+FKTD+ VPKLGVMLVG GGNNGSTLT GVIAN+EGISWATKD VQQANYFGSLTQAS+IRVGS+NGEEIYAPFKS+LPMVNPDD+VFGGWDISDMNLADAMARARV DIDLQKQLRPYME++VPLPGI+D DFIAANQGSRAN+VIKGTKKEQ+
Sbjct:    1 MFIESFKVESPNVKYTENEIHSVYDYETTEVVHEKTVNGTYQWIVKPKTVKYDFKTDIRVPKLGVMLVGLGGNNGSTLTAGVIANKEGISWATKDKVQQANYFGSLTQASSIRVGSFNGEEIYAPFKSLLPMVNPDDVVFGGWDISDMNLADAMARARVLDIDLQKQLRPYMENIVPLPGIFDPDFIAANQGSRANHVIKGTKKEQV 207          
The following BLAST results are available for this feature:
BLAST of FC929105 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 27
Match NameE-valueIdentityDescription
INO1_CITPA7.139e-11798.56Inositol-3-phosphate synthase OS=Citrus paradisi P... [more]
INO1_NICPA5.853e-11192.31Inositol-3-phosphate synthase OS=Nicotiana panicul... [more]
INO1_TOBAC1.703e-11092.31Inositol-3-phosphate synthase OS=Nicotiana tabacum... [more]
INO1_WHEAT4.195e-10990.87Inositol-3-phosphate synthase OS=Triticum aestivum... [more]
INO1_SESIN5.479e-10990.87Inositol-3-phosphate synthase OS=Sesamum indicum P... [more]
INO2_ARATH7.911e-10889.81Inositol-3-phosphate synthase isozyme 2 OS=Arabido... [more]
INO3_ARATH1.650e-10587.02Probable inositol-3-phosphate synthase isozyme 3 O... [more]
INO1_BRANA1.650e-10587.50Inositol-3-phosphate synthase OS=Brassica napus PE... [more]
INO1_MESCR3.675e-10588.94Inositol-3-phosphate synthase OS=Mesembryanthemum ... [more]
INO1_PHAVU5.306e-10488.41Inositol-3-phosphate synthase OS=Phaseolus vulgari... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAH3CC12RM1 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH3CC12, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929105 ID=FC929105|Name=FC929105|organism=Citrus clementina|type=EST|length=858bp
TAGTGTTGAGTCGAGTGGGAAGTGAGAATTGAGAAGGAGAGTCGAGTTCG
GAGACAGCAAGACGAAACAGCTCTTCTTCCAATAAATCTCAAAGCATTTG
TTTGGTTTTATTTAAAGCAATTTTCTCAGCAAACTCTTCTTCTAATAAAT
TTTAAAGCATTTGTTTGGTTTTTATTTAAAGCAATTTTCTCAGCGAAGTT
TTCAATTTTTTCTCTAAAATTTTCCTGGGAAAATGTTTATCGAAAATTTC
AAGGTTGAGAGCCCAAATGTGAAGTACACAGATAATGAGATTCACTCTGT
GTACGATTATGAAACCACTGAGCTTGTTCATGAGAACAGAAATGGCACTT
ATCAGTGGATTGTCAAGCCCAAAACTGTCAAATATGAGTTCAAAACCGAT
GTTCATGTCCCTAAACTTGGGGTTATGCTTGTGGGTTGGGGTGGAAACAA
CGGCTCAACTCTCACGGGTGGTGTTATCGCGAATCGAGAGGGAATCTCCT
GGGCCACAAAGGACACAGTGCAACAAGCCAATTATTTTGGTTCACTTACC
CAAGCATCAGCAATTAGAGTTGGGTCTTACAATGGAGAGGAGATTTATGC
TCCATTCAAGAGCATTCTCCCTATGGTGAACCCAGATGACATTGTGTTTG
GAGGATGGGACATTAGTGACATGAACTTGGCTGATGCCATGGCCAGGGCT
AGAGTGTTTGATATTGATCTTCAAAAGCAACTTAGGCCTTACATGGAATC
AATGGTCCCACTTCCTGGAATCTATGACCTTGATTTCATTGCTGCCAATC
AAGGGTCCCGTGCCAACAACGTGATCAAAGGAACCAAGAAAGAACAAATG
CTACAAAT
back to top