FC929265

Overview
NameFC929265
Unique NameFC929265
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length858
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig12500 contig Ccv1_Contig12500:6..863. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929265 vs. ExPASy Swiss-Prot
Match: UFOG_PETHY (Anthocyanidin 3-O-glucosyltransferase OS=Petunia hybrida GN=RT PE=2 SV=1)

HSP 1 Score: 315.464 bits (807), Expect = 2.491e-85
Identity = 157/259 (60.62%), Postives = 191/259 (73.75%), Query Frame = 1
Query:   94 DQLHVVMFPWFAFGHISPFVQLSNKLSLHGVKVSFFSAPGNIPRIKSSLNLTPMADIIPLQIPHVDGLPPGLDSTSEMTPHMAELLKQALDLMQPQIKTLLSQLKPHFVFFDFTHYWLPGLVGSQLGIKTVNFSVFSAISQAYLVVPARKLN----NSLADLMKSPDGFPATSITSLDEFVARDYLYVYTKFNGGPSVYERGIQGVDGCDVLAIKTCNEMEGPYLDFVRTQFQKPVSSTGPLCYPEPPSGELEERWAKW 858
            D LHVVMFP+FAFGHISPFVQL+NKLS +GVKVSFF+A GN  R+KS LN  P   I+PL +PHV+GLPPG +ST+E+TP  AELLK ALDLMQPQIKTLLS LKPHFV FDF   WLP +    LGIKTV +SV  A+S A+L  PAR L      SL D+ K P GFP TS+TS+  F ARD+LYV+  F+ GP++Y+R   G+ GC  +  KTC++MEGPY+ +V  QF KPV   GP+  P+PPSG+LEE+WA W
Sbjct:   10 DALHVVMFPFFAFGHISPFVQLANKLSSYGVKVSFFTASGNASRVKSMLNSAPTTHIVPLTLPHVEGLPPGAESTAELTPASAELLKVALDLMQPQIKTLLSHLKPHFVLFDFAQEWLPKMANG-LGIKTVYYSVVVALSTAFLTCPARVLEPKKYPSLEDMKKPPLGFPQTSVTSVRTFEARDFLYVFKSFHNGPTLYDRIQSGLRGCSAILAKTCSQMEGPYIKYVEAQFNKPVFLIGPV-VPDPPSGKLEEKWATW 266          
BLAST of FC929265 vs. ExPASy Swiss-Prot
Match: FLRT_CITMA (Flavanone 7-O-glucoside 2''-O-beta-L-rhamnosyltransferase OS=Citrus maxima GN=C12RT1 PE=1 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 2.544e-13
Identity = 61/247 (24.70%), Postives = 108/247 (43.72%), Query Frame = 1
Query:   79 ESAEADQLHVVMFPWFAFGHISPFVQLSNKLSLHGVKVSFFSAPGNIPRIKSSL--NLTPMADIIPLQIPHV-DGLPPGLDSTSEMTPHMAELLKQALDLMQPQIKTLLSQLKPHFVFFDFTHYWLPGLVGSQLGIKTVNFSVFSAISQAYLVVPARKLNNSLADLMKSPDGFPATSITSLDEFVARDYLYVYTKFNGGPSVYERGIQGVD-GCDVLAIKTCNEMEGPYLDFVRTQFQKPVSSTGPL 807
            ++   D+  ++M PW A GHI+P ++L+ KLS     + F S P N+     ++  N +    +I LQ+P+    LP    +T  + PH+   L  A +  +P    +L  LKP  V +D     +      Q  I  + F   SA++ ++L      L+N +   +K P        +   +  +++  Y       G    +R ++  +  C  + IKT  E+E  YLD+  +     +   GPL
Sbjct:    2 DTKHQDKPSILMLPWLAHGHIAPHLELAKKLSQKNFHIYFCSTPNNLQSFGRNVEKNFSSSIQLIELQLPNTFPELPSQNQTTKNLPPHLIYTLVGAFEDAKPAFCNILETLKPTLVMYDLFQP-MAAEAAYQYDIAAILFLPLSAVACSFL------LHNIVNPSLKYP-----FFESDYQDRESKNINYFLHLTANGTLNKDRFLKAFELSCKFVFIKTSREIESKYLDYFPSLMGNEIIPVGPL 236          
The following BLAST results are available for this feature:
BLAST of FC929265 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
UFOG_PETHY2.491e-8560.62Anthocyanidin 3-O-glucosyltransferase OS=Petunia h... [more]
FLRT_CITMA2.544e-1324.70Flavanone 7-O-glucoside 2''-O-beta-L-rhamnosyltran... [more]
back to top
Properties
Property NameValue
Genbank descriptionKN0AAH2AF04RM1 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH2AF04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929265 ID=FC929265|Name=FC929265|organism=Citrus clementina|type=EST|length=858bp
GGCAAGAGAGACACAGAGACCATGCACGCCTCTTCGAACATGCACGCCCC
TTCGAACCAACACCACAAAATGGGAACTGAATCAGCTGAAGCTGATCAGC
TTCACGTGGTGATGTTCCCATGGTTTGCTTTTGGTCACATAAGCCCCTTT
GTACAACTTTCCAACAAGCTCTCACTTCATGGAGTCAAGGTCTCTTTCTT
TTCGGCTCCTGGTAACATTCCCCGCATCAAATCATCGCTCAATTTAACTC
CCATGGCCGACATTATCCCTCTTCAAATCCCACACGTCGATGGCCTCCCT
CCTGGTCTTGATAGCACCTCAGAGATGACACCTCACATGGCTGAGCTCCT
AAAGCAAGCCTTGGACCTCATGCAACCACAAATCAAAACTTTGTTGTCAC
AGCTCAAACCCCATTTTGTGTTCTTTGATTTTACCCATTACTGGTTGCCG
GGTCTTGTTGGTTCTCAACTTGGCATCAAAACAGTTAACTTCTCTGTTTT
CTCTGCCATTTCACAAGCCTATCTCGTGGTTCCCGCCAGGAAACTCAACA
ACAGTTTAGCAGATCTAATGAAATCTCCCGATGGGTTCCCTGCAACTTCC
ATTACCTCGCTCGATGAATTTGTGGCTCGAGATTACTTGTATGTTTATAC
AAAGTTCAATGGCGGCCCGAGTGTTTATGAGAGAGGGATTCAGGGCGTTG
ATGGCTGCGATGTTCTTGCCATCAAGACATGTAATGAAATGGAGGGTCCT
TACCTGGATTTCGTGAGAACCCAGTTTCAGAAACCGGTTTCTTCTACCGG
TCCACTTTGTTATCCTGAGCCGCCATCCGGGGAGCTTGAAGAGAGATGGG
CTAAATGG
back to top