FC929270

Overview
NameFC929270
Unique NameFC929270
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length822
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig9284 contig Ccv1_Contig9284:2..823. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929270 vs. ExPASy Swiss-Prot
Match: SYNC1_ARATH (Asparaginyl-tRNA synthetase, cytoplasmic 1 OS=Arabidopsis thaliana GN=SYNC1 PE=2 SV=1)

HSP 1 Score: 332.028 bits (850), Expect = 2.400e-90
Identity = 157/195 (80.51%), Postives = 172/195 (88.21%), Query Frame = 3
Query:    3 DWLLDHCFDDMEFMAKNYDKSCINRLRMVASTPFERITYTXXXXXXXXXXKEGKHFENKVEWGIDLASEHERYLTEVKFQKPVIVYNYPKGIKAFYMRLNDDLKTVAAMDVLVPKVGELIGGSQREERYDVIKSRIEDMGLPLEPYEWYLDLRRFGTVKHSGFGLGFERMILFATGIDNIRDVIPFPRYPGRADL 587
            +WLL+ C+ DME MAKN+D  CI+RL++VASTPF RITYT           +GK F+N VEWGIDLASEHERYLTEV FQKP+IVYNYPKGIKAFYMRLNDD KTVAAMDVLVPKVGELIGGSQREERYDVIK RIE+MGLP+EPYEWYLDLRR+GTVKH GFGLGFERMILFATG+DNIRDVIPFPRYPG+ADL
Sbjct:  378 NWLLEKCYADMELMAKNFDSGCIDRLKLVASTPFGRITYTKAIELLEEAVAKGKEFDNNVEWGIDLASEHERYLTEVLFQKPLIVYNYPKGIKAFYMRLNDDEKTVAAMDVLVPKVGELIGGSQREERYDVIKKRIEEMGLPIEPYEWYLDLRRYGTVKHCGFGLGFERMILFATGLDNIRDVIPFPRYPGKADL 572          
BLAST of FC929270 vs. ExPASy Swiss-Prot
Match: SYNC3_ARATH (Asparaginyl-tRNA synthetase, cytoplasmic 3 OS=Arabidopsis thaliana GN=SYNC3 PE=2 SV=1)

HSP 1 Score: 314.309 bits (804), Expect = 5.180e-85
Identity = 154/196 (78.57%), Postives = 166/196 (84.69%), Query Frame = 3
Query:    6 WLLDHCFDDMEFMAKNYDKSCINRLRMVASTPFERITYTXXXXXXXXXXKEGKH-FENKVEWGIDLASEHERYLTEVKF-QKPVIVYNYPKGIKAFYMRLNDDLKTVAAMDVLVPKVGELIGGSQREERYDVIKSRIEDMGLPLEPYEWYLDLRRFGTVKHSGFGLGFERMILFATGIDNIRDVIPFPRYPGRADL 587
            WL+D C DDME M KN D+ C  RL MVA   F+R+TYT           +GK  F+NKVEWGIDLASEHERYLTEV+F QKP+IVYNYPKGIKAFYMRLNDD KTVAAMDVLVPKVGELIGGSQREERYDVIK RIE+MGLP+EPYEWYLDLRR+GTVKH GFGLGFERMI FATGIDNIRDVIPFPRYPG+ADL
Sbjct:  376 WLMDKCGDDMELMDKNVDEGCTKRLNMVAKASFKRVTYTEAIERLEKAVAQGKVVFDNKVEWGIDLASEHERYLTEVEFDQKPIIVYNYPKGIKAFYMRLNDDEKTVAAMDVLVPKVGELIGGSQREERYDVIKQRIEEMGLPMEPYEWYLDLRRYGTVKHCGFGLGFERMIQFATGIDNIRDVIPFPRYPGKADL 571          
BLAST of FC929270 vs. ExPASy Swiss-Prot
Match: SYN_DESVV (Asparaginyl-tRNA synthetase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=asnS PE=3 SV=1)

HSP 1 Score: 237.269 bits (604), Expect = 8.047e-62
Identity = 116/192 (60.42%), Postives = 141/192 (73.44%), Query Frame = 3
Query:    9 LLDHCFDDMEFMAKNYDKSCINRLRMVASTPFERITYTXXXXXXXXXXKEGKHFENKVEWGIDLASEHERYLTEVKFQKPVIVYNYPKGIKAFYMRLNDDLKTVAAMDVLVPKVGELIGGSQREERYDVIKSRIEDMGLPLEPYEWYLDLRRFGTVKHSGFGLGFERMILFATGIDNIRDVIPFPRYPGRAD 584
            +LD C  D++   +  D + + RLR +A  PF R +YT          K GK FE  V +G+DL +EHERYL E  F KPVIVYNYPK IKAFYMRLNDD +TVAAMDVLVP++GELIGGSQREER DV+++RI +MG  LE Y WYLDLRRFG+V H+GFG+GFER+++  TGI NIRDVIPFPR PG  +
Sbjct:  272 ILDRCAADLDLFNRFVDTTLVERLRQIADEPFARCSYTEAIELLL---KSGKKFEYPVSFGLDLQTEHERYLAEEHFGKPVIVYNYPKEIKAFYMRLNDDGRTVAAMDVLVPRIGELIGGSQREERLDVLEARINEMGQNLEDYWWYLDLRRFGSVPHAGFGMGFERLLMLLTGITNIRDVIPFPRTPGNLE 460          
BLAST of FC929270 vs. ExPASy Swiss-Prot
Match: SYN_DESVH (Asparaginyl-tRNA synthetase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=asnS PE=3 SV=1)

HSP 1 Score: 237.269 bits (604), Expect = 8.047e-62
Identity = 116/192 (60.42%), Postives = 141/192 (73.44%), Query Frame = 3
Query:    9 LLDHCFDDMEFMAKNYDKSCINRLRMVASTPFERITYTXXXXXXXXXXKEGKHFENKVEWGIDLASEHERYLTEVKFQKPVIVYNYPKGIKAFYMRLNDDLKTVAAMDVLVPKVGELIGGSQREERYDVIKSRIEDMGLPLEPYEWYLDLRRFGTVKHSGFGLGFERMILFATGIDNIRDVIPFPRYPGRAD 584
            +LD C  D++   +  D + + RLR +A  PF R +YT          K GK FE  V +G+DL +EHERYL E  F KPVIVYNYPK IKAFYMRLNDD +TVAAMDVLVP++GELIGGSQREER DV+++RI +MG  LE Y WYLDLRRFG+V H+GFG+GFER+++  TGI NIRDVIPFPR PG  +
Sbjct:  272 ILDRCAADLDLFNRFVDTTLVERLRQIADEPFARCSYTEAIELLL---KSGKKFEYPVSFGLDLQTEHERYLAEEHFGKPVIVYNYPKEIKAFYMRLNDDGRTVAAMDVLVPRIGELIGGSQREERLDVLEARINEMGQNLEDYWWYLDLRRFGSVPHAGFGMGFERLLMLLTGITNIRDVIPFPRTPGNLE 460          
BLAST of FC929270 vs. ExPASy Swiss-Prot
Match: SYN_PARUW (Asparaginyl-tRNA synthetase OS=Protochlamydia amoebophila (strain UWE25) GN=asnS PE=3 SV=1)

HSP 1 Score: 235.728 bits (600), Expect = 2.341e-61
Identity = 115/193 (59.59%), Postives = 145/193 (75.13%), Query Frame = 3
Query:    6 WLLDHCFDDMEFMAKNYDKSCINRLRMVASTPFERITYTXXXXXXXXXXKEGKHFENKVEWGIDLASEHERYLTEVKFQKPVIVYNYPKGIKAFYMRLNDDLKTVAAMDVLVPKVGELIGGSQREERYDVIKSRIEDMGLPLEPYEWYLDLRRFGTVKHSGFGLGFERMILFATGIDNIRDVIPFPRYPGRAD 584
            ++LD+C +DMEF  K+     I+RL  V +T FER +YT          K  K FE  V+WG+DL SEHER+L E  F KPVI+ +YPK IKAFYMR N+D KTVAAMDVLVPKVGE+IGGSQREER  V++S++++  LP E Y WYL+LR+FG+V HSGFG GFER++ F TG++NIRDVIPFPR+PG+AD
Sbjct:  277 YVLDNCQEDMEFFNKHVATDLISRLEHVINTSFERASYTYAVRILE---KADKKFEYPVKWGLDLQSEHERFLAEEFFGKPVILTDYPKDIKAFYMRTNEDNKTVAAMDVLVPKVGEIIGGSQREERLSVLESKLKEFNLPAEEYWWYLELRKFGSVPHSGFGAGFERLVQFTTGMENIRDVIPFPRHPGKAD 466          
BLAST of FC929270 vs. ExPASy Swiss-Prot
Match: SYN_ACTSZ (Asparaginyl-tRNA synthetase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=asnS PE=3 SV=1)

HSP 1 Score: 235.728 bits (600), Expect = 2.341e-61
Identity = 116/186 (62.37%), Postives = 137/186 (73.66%), Query Frame = 3
Query:   27 DDMEFMAKNYDKSCINRLRMVASTPFERITYTXXXXXXXXXXKEGKHFENKVEWGIDLASEHERYLTEVKFQKPVIVYNYPKGIKAFYMRLNDDLKTVAAMDVLVPKVGELIGGSQREERYDVIKSRIEDMGLPLEPYEWYLDLRRFGTVKHSGFGLGFERMILFATGIDNIRDVIPFPRYPGRAD 584
            DD+EF +K+ DK  I RL    ++PF +I YT          K GK FE  V WGIDL+SEHERYL E  F+ PV+V NYPKGIKAFYMRLNDD KTVAAMDVL P +GE+IGGSQREER DV+  R+ +MGL  E Y WY DLR++GTV HSGFGLGFER+I++ TG+ NIRDVIPFPR P  A+
Sbjct:  284 DDLEFFSKHVDKDVITRLEHFVNSPFAQIDYTDAIDVLV---KSGKKFEFPVSWGIDLSSEHERYLAEEHFKSPVVVKNYPKGIKAFYMRLNDDGKTVAAMDVLAPGIGEIIGGSQREERLDVLDKRMVEMGLKPEDYWWYRDLRKYGTVPHSGFGLGFERLIVYVTGVQNIRDVIPFPRSPRNAN 466          
BLAST of FC929270 vs. ExPASy Swiss-Prot
Match: SYN_THEEB (Asparaginyl-tRNA synthetase OS=Thermosynechococcus elongatus (strain BP-1) GN=asnS PE=3 SV=1)

HSP 1 Score: 234.958 bits (598), Expect = 3.994e-61
Identity = 113/193 (58.55%), Postives = 140/193 (72.54%), Query Frame = 3
Query:    6 WLLDHCFDDMEFMAKNYDKSCINRLRMVASTPFERITYTXXXXXXXXXXKEGKHFENKVEWGIDLASEHERYLTEVKFQKPVIVYNYPKGIKAFYMRLNDDLKTVAAMDVLVPKVGELIGGSQREERYDVIKSRIEDMGLPLEPYEWYLDLRRFGTVKHSGFGLGFERMILFATGIDNIRDVIPFPRYPGRAD 584
            ++LDHC +DM F  +  D S +     +A+ PF  ++Y+          K G+ FE  V WG+DL SEHERYL E   Q+PVIVY+YP  IKAFYMRLNDD KTVAAMD+L PK+GE+IGGSQREER+DV++ RI   GL   PY WYLDLRR+G+V H+GFGLGFER++ F TG+DNIRDVIPFPR PG A+
Sbjct:  272 YVLDHCPEDMAFFQERIDHSVMATAEQMATQPFAHLSYSEAIQVLE---KSGRAFEFPVAWGLDLQSEHERYLAEEYCQRPVIVYDYPAAIKAFYMRLNDDGKTVAAMDILAPKIGEIIGGSQREERFDVLQERIVTQGLDPAPYWWYLDLRRYGSVPHAGFGLGFERLVQFMTGMDNIRDVIPFPRTPGNAE 461          
BLAST of FC929270 vs. ExPASy Swiss-Prot
Match: SYN_PORGI (Asparaginyl-tRNA synthetase OS=Porphyromonas gingivalis GN=asnS PE=3 SV=1)

HSP 1 Score: 234.572 bits (597), Expect = 5.216e-61
Identity = 109/193 (56.48%), Postives = 138/193 (71.50%), Query Frame = 3
Query:    6 WLLDHCFDDMEFMAKNYDKSCINRLRMVASTPFERITYTXXXXXXXXXXKEGKHFENKVEWGIDLASEHERYLTEVKFQKPVIVYNYPKGIKAFYMRLNDDLKTVAAMDVLVPKVGELIGGSQREERYDVIKSRIEDMGLPLEPYEWYLDLRRFGTVKHSGFGLGFERMILFATGIDNIRDVIPFPRYPGRAD 584
            W LD+C DD+ F+++++DK  I+RL+ V   PF R+ YT          K G  FE  + WG DLASEHERYL EV F+ PVI+ +YPK IK+FYM+LNDD KTV  MDVL PK+GE+IGGS+RE  YD + +R  +MG+P +   WYLD RR+GT  HSGFGLGFER++LF TG+ NIRDVIPFPR P  A+
Sbjct:  276 WALDNCMDDISFLSEHFDKELIDRLKFVLEKPFVRLAYTEGIRILEEAVKNGVKFEFPIYWGADLASEHERYLVEVHFKTPVIMTDYPKEIKSFYMKLNDDGKTVRGMDVLFPKIGEIIGGSEREADYDKLVARANEMGVPEKDIWWYLDSRRYGTAPHSGFGLGFERLLLFVTGMSNIRDVIPFPRTPNNAE 468          
BLAST of FC929270 vs. ExPASy Swiss-Prot
Match: SYN_PORG3 (Asparaginyl-tRNA synthetase OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=asnS PE=3 SV=1)

HSP 1 Score: 234.572 bits (597), Expect = 5.216e-61
Identity = 109/193 (56.48%), Postives = 138/193 (71.50%), Query Frame = 3
Query:    6 WLLDHCFDDMEFMAKNYDKSCINRLRMVASTPFERITYTXXXXXXXXXXKEGKHFENKVEWGIDLASEHERYLTEVKFQKPVIVYNYPKGIKAFYMRLNDDLKTVAAMDVLVPKVGELIGGSQREERYDVIKSRIEDMGLPLEPYEWYLDLRRFGTVKHSGFGLGFERMILFATGIDNIRDVIPFPRYPGRAD 584
            W LD+C DD+ F+++++DK  I+RL+ V   PF R+ YT          K G  FE  + WG DLASEHERYL EV F+ PVI+ +YPK IK+FYM+LNDD KTV  MDVL PK+GE+IGGS+RE  YD + +R  +MG+P +   WYLD RR+GT  HSGFGLGFER++LF TG+ NIRDVIPFPR P  A+
Sbjct:  276 WALDNCMDDISFLSEHFDKELIDRLKFVLEKPFVRLAYTEGIRILEEAVKNGVKFEFPIYWGADLASEHERYLVEVHFKTPVIMTDYPKEIKSFYMKLNDDGKTVRGMDVLFPKIGEIIGGSEREADYDKLVARANEMGVPEKDIWWYLDSRRYGTAPHSGFGLGFERLLLFVTGMSNIRDVIPFPRTPNNAE 468          
BLAST of FC929270 vs. ExPASy Swiss-Prot
Match: SYN_COLP3 (Asparaginyl-tRNA synthetase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=asnS PE=3 SV=1)

HSP 1 Score: 231.876 bits (590), Expect = 3.381e-60
Identity = 111/185 (60.00%), Postives = 135/185 (72.97%), Query Frame = 3
Query:   27 DDMEFMAKNYDKSCINRLRMVASTPFERITYTXXXXXXXXXXKEGKHFENKVEWGIDLASEHERYLTEVKFQKPVIVYNYPKGIKAFYMRLNDDLKTVAAMDVLVPKVGELIGGSQREERYDVIKSRIEDMGLPLEPYEWYLDLRRFGTVKHSGFGLGFERMILFATGIDNIRDVIPFPRYPGRA 581
            DDM F  +  DK+ ++RL  V +T F R+ YT            GK FEN+V WG+DL SEHERYL E  F  PV++ NYPK IK+FYMRLNDD KTVAAMD+L P +GE+IGGSQREER DV+ SR+E+MGL +  Y WY DLRR+GTV HSGFGLGFER++ +ATG+ N+RDVIPFPR P  A
Sbjct:  283 DDMAFFQQRVDKTVLDRLNSVINTDFVRLDYTDAITILENC---GKKFENQVSWGVDLNSEHERYLAEEHFNGPVVLQNYPKDIKSFYMRLNDDGKTVAAMDILAPGIGEIIGGSQREERLDVLDSRLEEMGLDIADYGWYRDLRRYGTVPHSGFGLGFERLVAYATGMQNVRDVIPFPRTPNNA 464          
The following BLAST results are available for this feature:
BLAST of FC929270 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 320
Match NameE-valueIdentityDescription
SYNC1_ARATH2.400e-9080.51Asparaginyl-tRNA synthetase, cytoplasmic 1 OS=Arab... [more]
SYNC3_ARATH5.180e-8578.57Asparaginyl-tRNA synthetase, cytoplasmic 3 OS=Arab... [more]
SYN_DESVV8.047e-6260.42Asparaginyl-tRNA synthetase OS=Desulfovibrio vulga... [more]
SYN_DESVH8.047e-6260.42Asparaginyl-tRNA synthetase OS=Desulfovibrio vulga... [more]
SYN_PARUW2.341e-6159.59Asparaginyl-tRNA synthetase OS=Protochlamydia amoe... [more]
SYN_ACTSZ2.341e-6162.37Asparaginyl-tRNA synthetase OS=Actinobacillus succ... [more]
SYN_THEEB3.994e-6158.55Asparaginyl-tRNA synthetase OS=Thermosynechococcus... [more]
SYN_PORGI5.216e-6156.48Asparaginyl-tRNA synthetase OS=Porphyromonas gingi... [more]
SYN_PORG35.216e-6156.48Asparaginyl-tRNA synthetase OS=Porphyromonas gingi... [more]
SYN_COLP33.381e-6060.00Asparaginyl-tRNA synthetase OS=Colwellia psychrery... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAH2AF09RM1 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH2AF09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929270 ID=FC929270|Name=FC929270|organism=Citrus clementina|type=EST|length=822bp
GTGACTGGTTACTTGACCATTGCTTTGACGACATGGAGTTTATGGCTAAA
AATTATGATAAAAGTTGCATTAACCGTCTAAGAATGGTTGCTTCAACTCC
CTTTGAACGCATAACATACACTGAAGCAGTAGAGCTACTAGAGGTTGCTG
TGAAGGAGGGGAAACATTTTGAGAATAAAGTGGAGTGGGGGATTGATTTG
GCATCTGAGCATGAAAGATACTTAACTGAGGTCAAATTTCAGAAGCCTGT
CATTGTGTACAACTATCCAAAAGGAATCAAAGCATTTTACATGAGGCTCA
ATGATGACTTGAAGACTGTGGCAGCTATGGATGTCCTTGTACCTAAGGTA
GGAGAGTTAATTGGTGGGAGCCAAAGGGAAGAGCGTTATGATGTAATCAA
GAGCAGAATAGAGGACATGGGACTCCCTCTTGAACCATACGAGTGGTACC
TTGACCTGCGGCGCTTTGGGACAGTGAAACATAGTGGGTTTGGCTTAGGC
TTTGAACGGATGATTCTTTTTGCCACAGGCATCGACAACATTAGAGATGT
TATCCCCTTCCCAAGATATCCCGGAAGAGCAGATCTCTAATCTTGAATTT
GCAAACATGCCTTTTTGAAAAATCACTAGTTATTACATCTTTTGCTGATT
CCAAACAATGTTAAACCAGGAAACCATAACATTGAAATTTATGTTTGCCA
TATTCTTAATGATAGAGATATTTTCTGGATTTGTCTTCTGNCAGCGTTTA
CGGCGGAATTATGATTTATTATTAGAGAATATATTAATAGAATTTTGATT
GTAATAAAAAAAAAAAAAAAAA
back to top