FC929281
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of FC929281 vs. ExPASy Swiss-Prot
Match: SSG1_ANTMA (Granule-bound starch synthase 1, chloroplastic/amyloplastic OS=Antirrhinum majus GN=WAXY PE=2 SV=1) HSP 1 Score: 97.8265 bits (242), Expect = 2.002e-20 Identity = 46/68 (67.65%), Postives = 57/68 (83.82%), Query Frame = 2 Query: 2 TTVIKALATCGTLALAEMMKNGMAHDLSWKGPSKKWEETLLNLKVAGREPGIDGEQIAPLAKENVATP 205 TTV +ALA G++A EM++N MA DLSWKGP+K WE+ LL+L V+G EPG+DGE+IAPLAKENVATP Sbjct: 541 TTVERALAAYGSVAYKEMIQNCMAQDLSWKGPAKNWEKMLLSLGVSGSEPGVDGEEIAPLAKENVATP 608
BLAST of FC929281 vs. ExPASy Swiss-Prot
Match: SSG1_IPOBA (Granule-bound starch synthase 1, chloroplastic/amyloplastic OS=Ipomoea batatas GN=WAXY PE=2 SV=2) HSP 1 Score: 97.4413 bits (241), Expect = 2.615e-20 Identity = 46/68 (67.65%), Postives = 56/68 (82.35%), Query Frame = 2 Query: 2 TTVIKALATCGTLALAEMMKNGMAHDLSWKGPSKKWEETLLNLKVAGREPGIDGEQIAPLAKENVATP 205 TTV +ALA GTLA EM+KN M+ +LSWKGP+K WE LL+L VAG EPG++G++IAPLAKENVATP Sbjct: 541 TTVGRALAMYGTLAFTEMIKNCMSQELSWKGPAKNWETVLLSLGVAGSEPGVEGDEIAPLAKENVATP 608
BLAST of FC929281 vs. ExPASy Swiss-Prot
Match: SSG1_SOLTU (Granule-bound starch synthase 1, chloroplastic/amyloplastic OS=Solanum tuberosum GN=WAXY PE=1 SV=1) HSP 1 Score: 97.0561 bits (240), Expect = 3.415e-20 Identity = 46/68 (67.65%), Postives = 55/68 (80.88%), Query Frame = 2 Query: 2 TTVIKALATCGTLALAEMMKNGMAHDLSWKGPSKKWEETLLNLKVAGREPGIDGEQIAPLAKENVATP 205 TTV +ALA GTLA AEM+KN M+ +LSWK P+KKWE LL L +G EPG++GE+IAPLAKENVATP Sbjct: 540 TTVARALAVYGTLAFAEMIKNCMSEELSWKEPAKKWETLLLGLGASGSEPGVEGEEIAPLAKENVATP 607
BLAST of FC929281 vs. ExPASy Swiss-Prot
Match: SSG1_SORBI (Granule-bound starch synthase 1, chloroplastic/amyloplastic OS=Sorghum bicolor GN=WAXY PE=2 SV=1) HSP 1 Score: 91.6633 bits (226), Expect = 1.435e-18 Identity = 44/68 (64.71%), Postives = 52/68 (76.47%), Query Frame = 2 Query: 2 TTVIKALATCGTLALAEMMKNGMAHDLSWKGPSKKWEETLLNLKVAGREPGIDGEQIAPLAKENVATP 205 TT+ +A+ GT A EM+KN M DLSWKGP+K WE LL+L VAG EPGI+GE+IAPLAKENVA P Sbjct: 541 TTLKRAIKVVGTPAYEEMVKNCMIQDLSWKGPAKNWENVLLSLGVAGGEPGIEGEEIAPLAKENVAAP 608
BLAST of FC929281 vs. ExPASy Swiss-Prot
Match: SSG1_MANES (Granule-bound starch synthase 1, chloroplastic/amyloplastic OS=Manihot esculenta GN=WAXY PE=2 SV=1) HSP 1 Score: 90.5077 bits (223), Expect = 3.197e-18 Identity = 43/67 (64.18%), Postives = 52/67 (77.61%), Query Frame = 2 Query: 5 TVIKALATCGTLALAEMMKNGMAHDLSWKGPSKKWEETLLNLKVAGREPGIDGEQIAPLAKENVATP 205 TV +AL T T AL EM+ N MA DLSWKGP++ WE+ LL+L+V G EPG +GE+IAPLAKENV TP Sbjct: 542 TVARALGTYATAALREMILNCMAQDLSWKGPARMWEKMLLDLEVTGSEPGTEGEEIAPLAKENVPTP 608
BLAST of FC929281 vs. ExPASy Swiss-Prot
Match: SSG1_MAIZE (Granule-bound starch synthase 1, chloroplastic/amyloplastic OS=Zea mays GN=WAXY PE=3 SV=1) HSP 1 Score: 90.1225 bits (222), Expect = 4.175e-18 Identity = 42/68 (61.76%), Postives = 52/68 (76.47%), Query Frame = 2 Query: 2 TTVIKALATCGTLALAEMMKNGMAHDLSWKGPSKKWEETLLNLKVAGREPGIDGEQIAPLAKENVATP 205 TT+ +A+ GT A EM++N M DLSWKGP+K WE LL+L VAG EPG++GE+IAPLAKENVA P Sbjct: 538 TTLQRAIKVVGTPAYEEMVRNCMIQDLSWKGPAKNWENVLLSLGVAGGEPGVEGEEIAPLAKENVAAP 605
BLAST of FC929281 vs. ExPASy Swiss-Prot
Match: SSG1_ORYSA (Granule-bound starch synthase 1, chloroplastic/amyloplastic OS=Oryza sativa GN=WAXY PE=3 SV=1) HSP 1 Score: 88.9669 bits (219), Expect = 9.301e-18 Identity = 42/68 (61.76%), Postives = 51/68 (75.00%), Query Frame = 2 Query: 2 TTVIKALATCGTLALAEMMKNGMAHDLSWKGPSKKWEETLLNLKVAGREPGIDGEQIAPLAKENVATP 205 TT+ +A+ GT A EM++N M DLSWKGP+K WE LL L VAG EPG++GE+IAPLAKENVA P Sbjct: 539 TTLKRAIKIVGTPAYNEMVRNCMNQDLSWKGPAKNWENVLLGLGVAGSEPGVEGEEIAPLAKENVAAP 606
BLAST of FC929281 vs. ExPASy Swiss-Prot
Match: SSG1_ARATH (Probable granule-bound starch synthase 1, chloroplastic/amyloplastic OS=Arabidopsis thaliana GN=WAXY PE=2 SV=1) HSP 1 Score: 87.0409 bits (214), Expect = 3.534e-17 Identity = 41/66 (62.12%), Postives = 51/66 (77.27%), Query Frame = 2 Query: 8 VIKALATCGTLALAEMMKNGMAHDLSWKGPSKKWEETLLNLKVAGREPGIDGEQIAPLAKENVATP 205 V +A+A GT A+ EM+KN M D SWKGP++ WE+ LL+L VAG E G +GE+IAPLAKENVATP Sbjct: 545 VTRAVAVYGTSAMQEMVKNCMDQDFSWKGPARLWEKVLLSLNVAGSEAGTEGEEIAPLAKENVATP 610
BLAST of FC929281 vs. ExPASy Swiss-Prot
Match: SSG1_HORVU (Granule-bound starch synthase 1, chloroplastic/amyloplastic OS=Hordeum vulgare GN=WAXY PE=1 SV=1) HSP 1 Score: 85.8853 bits (211), Expect = 7.874e-17 Identity = 42/68 (61.76%), Postives = 49/68 (72.06%), Query Frame = 2 Query: 2 TTVIKALATCGTLALAEMMKNGMAHDLSWKGPSKKWEETLLNLKVAGREPGIDGEQIAPLAKENVATP 205 TT+ +A+ GT A EM+KN M DLSWKGP+K WE+ LL L V G EPGI GE+IAPLA ENVA P Sbjct: 536 TTLKRAVKVVGTPAYQEMVKNCMIQDLSWKGPAKNWEDVLLELGVEGSEPGIVGEEIAPLAMENVAAP 603
BLAST of FC929281 vs. ExPASy Swiss-Prot
Match: SSG1B_HORVU (Granule-bound starch synthase 1b, chloroplastic/amyloplastic (Fragment) OS=Hordeum vulgare PE=1 SV=1) HSP 1 Score: 85.5001 bits (210), Expect = 1.028e-16 Identity = 41/68 (60.29%), Postives = 51/68 (75.00%), Query Frame = 2 Query: 2 TTVIKALATCGTLALAEMMKNGMAHDLSWKGPSKKWEETLLNLKVAGREPGIDGEQIAPLAKENVATP 205 + V +AL T M++N MA DLSWKGP+KKWEE LL+L V G +PGI+GE+IAPLAK+NVATP Sbjct: 498 SNVTRALKQYRTPVFHAMVQNCMAQDLSWKGPAKKWEEALLSLGVEGSQPGIEGEEIAPLAKQNVATP 565 The following BLAST results are available for this feature:
BLAST of FC929281 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 15
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >FC929281 ID=FC929281; Name=FC929281; organism=Citrus clementina; type=EST; length=440bpback to top |