FC929347

Overview
NameFC929347
Unique NameFC929347
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length889
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig15206 contig Ccv1_Contig15206:12..900. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929347 vs. ExPASy Swiss-Prot
Match: 21KD_DAUCA (21 kDa protein OS=Daucus carota PE=2 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 3.043e-33
Identity = 80/194 (41.24%), Postives = 123/194 (63.40%), Query Frame = 3
Query:   30 RHTLV--ALLIILLEFSTNLASNPSDNSNIEYIRTSCSGTIYRRLCYRSLSVYAAKIKSNPKTLANTALNITLKATKSTSRMMVKMSRIPGMIPRETAGAVADCIEVIGDSIDELQDSMDE---LGHIRNSNFWLTMGDVQTWVSAALTYEDTCVDGLQGRPLNGYTKTMIRRHILKVAHLTSNALALINSYAA 596
            + TLV  ALL+IL   S   A+        ++I+TSC+ T Y  +C +SLS YA  I++NP+ LA+TAL ++L  T+     M ++++  G+  R+ A A+ DC+E + DS+D +  S DE   L H + ++F   M +V+TWVSAALT E TC+DG  G+ ++G  K  +R  ++ VA +TSNALAL+N++AA
Sbjct:    5 KSTLVFSALLVILAAASAAPAN--------QFIKTSCTLTTYPAVCEQSLSAYAKTIQNNPQELASTALQVSLTRTQQAQTFMKRLNKFKGLKARQYA-AIHDCLEEVEDSLDRVSRSCDEMKNLSHAKGNDFTFRMSNVETWVSAALTDETTCMDGFAGKGMDGKIKESVRAQVVAVARVTSNALALVNNFAA 189          
BLAST of FC929347 vs. ExPASy Swiss-Prot
Match: PME2_ARATH (Pectinesterase 2 OS=Arabidopsis thaliana GN=PME2 PE=2 SV=2)

HSP 1 Score: 80.8777 bits (198), Expect = 1.087e-14
Identity = 50/189 (26.46%), Postives = 102/189 (53.97%), Query Frame = 3
Query:   39 LVALLIILLEFSTNLASNPS----DNSNIEYIRTSCSGTIYRRLCYRSLSVYAAKIKSNPKTLANTALNITLKATKSTSRMMVKM-SRIPGMIPRETAGAVADCIEVIGDSIDELQDSMDELGHI-RNSNFWLTMGDVQTWVSAALTYEDTCVDGLQGRPLNGYTKTMIRRHILKVAHLTSNALALINS 587
            L+A ++ +   +TN   N       +++   +++ CS T+Y  LC+ +++    K  ++ K +   +LN+T KA K     + K+ ++  G+ PRE   A+ DC+E I +++DEL  ++++L    +  +      D++T +S+A+T + TC+DG      +   +  + +  + V H+ SNALA+I +
Sbjct:   31 LLASIVGIAATTTNQNKNQKITTLSSTSHAILKSVCSSTLYPELCFSAVAATGGKELTSQKEVIEASLNLTTKAVKHNYFAVKKLIAKRKGLTPREVT-ALHDCLETIDETLDELHVAVEDLHQYPKQKSLRKHADDLKTLISSAITNQGTCLDGFSYDDADRKVRKALLKGQVHVEHMCSNALAMIKN 218          
BLAST of FC929347 vs. ExPASy Swiss-Prot
Match: PME3_CITSI (Pectinesterase 3 OS=Citrus sinensis PE=1 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 4.132e-14
Identity = 55/201 (27.36%), Postives = 102/201 (50.75%), Query Frame = 3
Query:    3 RKRMEGSFLRHTLVALLIILLEFSTNLASNPSDNSNIEY---IRTSCSGTIYRRLCYRSLSVY--AAKIKSNPKTLANTALNITLKATKSTSRMMVKMSRIPGMIPRETAGAVADCIEVIGDSIDELQDSMDELGHIRNS-NFWLTMGDVQTWVSAALTYEDTCVDGLQGRPLNGYTKTMIRRHILKVAHLTSNALALINS 587
            +K++  +     LV   +I +    N   N  DN N  +   +++SCS T Y  LC+ +++    A+K  ++ K +   +LNIT  A +     + K+ +   +  RE   A+ DC+E I +++DEL  ++++L    N  +      D++T +SAA+T + TC+DG      N + +  +    + V  + SNALA+I +
Sbjct:   27 KKKLFLALFATLLVVAAVIGIVAGVNSRKNSGDNGNEPHHAILKSSCSSTRYPDLCFSAIAAVPEASKKVTSQKDVIEMSLNITTTAVEHNYFGIQKLLKRTNLTKREKV-ALHDCLETIDETLDELHKAVEDLEEYPNKKSLSQHADDLKTLMSAAMTNQGTCLDGFSHDDANKHVRDALSDGQVHVEKMCSNALAMIKN 226          
BLAST of FC929347 vs. ExPASy Swiss-Prot
Match: PME1_CITSI (Pectinesterase 1 OS=Citrus sinensis GN=PECS-1.1 PE=2 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 4.132e-14
Identity = 55/201 (27.36%), Postives = 102/201 (50.75%), Query Frame = 3
Query:    3 RKRMEGSFLRHTLVALLIILLEFSTNLASNPSDNSNIEY---IRTSCSGTIYRRLCYRSLSVY--AAKIKSNPKTLANTALNITLKATKSTSRMMVKMSRIPGMIPRETAGAVADCIEVIGDSIDELQDSMDELGHIRNS-NFWLTMGDVQTWVSAALTYEDTCVDGLQGRPLNGYTKTMIRRHILKVAHLTSNALALINS 587
            +K++  +     LV   +I +    N   N  DN N  +   +++SCS T Y  LC+ +++    A+K  ++ K +   +LNIT  A +     + K+ +   +  RE   A+ DC+E I +++DEL  ++++L    N  +      D++T +SAA+T + TC+DG      N + +  +    + V  + SNALA+I +
Sbjct:   27 KKKLFLALFATLLVVAAVIGIVAGVNSRKNSGDNGNEPHHAILKSSCSSTRYPDLCFSAIAAVPEASKKVTSQKDVIEMSLNITTTAVEHNYFGIQKLLKRTNLTKREKV-ALHDCLETIDETLDELHKAVEDLEEYPNKKSLSQHADDLKTLMSAAMTNQGTCLDGFSHDDANKHVRDALSDGQVHVEKMCSNALAMIKN 226          
BLAST of FC929347 vs. ExPASy Swiss-Prot
Match: PME3_ARATH (Pectinesterase/pectinesterase inhibitor 3 OS=Arabidopsis thaliana GN=PME3 PE=2 SV=2)

HSP 1 Score: 78.5666 bits (192), Expect = 5.397e-14
Identity = 47/161 (29.19%), Postives = 92/161 (57.14%), Query Frame = 3
Query:  120 IRTSCSGTIYRRLCYRSLSVYAAKIKSNPKTLANTALNITLKATKS---TSRMMVKMSRIPGMIPRETAGAVADCIEVIGDSIDELQDSMDELGHIRNSNFWLT--MGDVQTWVSAALTYEDTCVDGLQGRPLNGYTKTMIRRHILKVAHLTSNALALINS 587
            +R+SCS T Y  LC  ++        ++ K +   ++N+T+ A +    T + ++K  +  G+ PRE   A+ DC+E I +++DEL +++++L H+  +   L    GD++T +S+A+T ++TC+DG      +   +  + +  + V H+ SNALA+I +
Sbjct:   59 LRSSCSSTRYPELCISAVVTAGGVELTSQKDVIEASVNLTITAVEHNYFTVKKLIKKRK--GLTPREKT-ALHDCLETIDETLDELHETVEDL-HLYPTKKTLREHAGDLKTLISSAITNQETCLDGFSHDDADKQVRKALLKGQIHVEHMCSNALAMIKN 215          
BLAST of FC929347 vs. ExPASy Swiss-Prot
Match: PME28_ARATH (Putative pectinesterase/pectinesterase inhibitor 28 OS=Arabidopsis thaliana GN=PME28 PE=2 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 1.018e-12
Identity = 55/190 (28.95%), Postives = 91/190 (47.89%), Query Frame = 3
Query:   42 VALLIILLEFSTNLASNPSDNSNIEYIRTS-------CSGTIYRRLCYRSLSVYAAKIKSNPKTLANTALNITLKATKST---SRMMVKMSRIPGMIPRETAGAVADCIEVIGDSIDELQDSMDELGHIRNSNFWLTMGDVQTWVSAALTYEDTCVDGLQGRPLNGYTKTMIRRHILKVAHLTSNALALI 581
            V L+ +++  +  ++ N SDN+  E I TS       C+ T Y+  C  +L    AK  S+P  L  TA N T+K        S+ M+++ + P         A+  C E++  +I EL  S +ELG          +  ++ W+SA +++E TC+DG QG    G     I++ +     LT N LA++
Sbjct:   24 VLLISMVVAVTIGVSVNKSDNAGDEEITTSVKAIKDVCAPTDYKETCEDTLRK-DAKDTSDPLELVKTAFNATMKQISDVAKKSQTMIELQKDP-----RAKMALDQCKELMDYAIGELSKSFEELGKFEFHKVDEALVKLRIWLSATISHEQTCLDGFQG--TQGNAGETIKKALKTAVQLTHNGLAMV 205          
BLAST of FC929347 vs. ExPASy Swiss-Prot
Match: PMEU1_SOLLC (Pectinesterase/pectinesterase inhibitor U1 OS=Solanum lycopersicum GN=PMEU1 PE=2 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 2.267e-12
Identity = 52/194 (26.80%), Postives = 106/194 (54.64%), Query Frame = 3
Query:   39 LVALLIILLEFSTNLASNPSDNSNI--------EYIRTSCSGTIYRRLCYRSL---SVYAAKIKSNPKTLANTALNITLKATKSTSRMMVKMSRI-PGMIPRETAGAVADCIEVIGDSIDELQDSMDELGHIRNSNFWLT-MGDVQTWVSAALTYEDTCVDGLQGRPLNGYTKTMIRRHILKVAHLTSNALALI 581
            LVA +I ++    + + N  D+++I          ++++CS T++  LCY ++   S ++ K+ S  K +   +LNIT+KA +     + ++ +   G+ PRE   A+ DC+E + +++DEL  ++++L    N       + D++T +S+A+T ++TC+DG      +   + ++ +    V  + SNALA+I
Sbjct:   31 LVAAVIGVVAGVKSHSKNSDDHADIMAISSSAHAIVKSACSNTLHPELCYSAIVNVSDFSKKVTSQ-KDVIELSLNITVKAVRRNYYAVKELIKTRKGLTPREKV-ALHDCLETMDETLDELHTAVEDLELYPNKKSLKEHVEDLKTLISSAITNQETCLDGFSHDEADKKVRKVLLKGQKHVEKMCSNALAMI 222          
BLAST of FC929347 vs. ExPASy Swiss-Prot
Match: PME21_ARATH (Probable pectinesterase/pectinesterase inhibitor 21 OS=Arabidopsis thaliana GN=PME21 PE=2 SV=2)

HSP 1 Score: 72.7886 bits (177), Expect = 2.961e-12
Identity = 43/161 (26.71%), Postives = 85/161 (52.80%), Query Frame = 3
Query:  102 NSNIEYIRTSCSGTIYRRLCYRSLSVYAAKIKSNPKTLANTALNITLKATKSTSRMMVKMSRIPGMIPRETAGAVADCIEVIGDSIDELQDSMDELGHIRNSNFWLTMGDVQTWVSAALTYEDTCVDGLQGRPLNGYTKTMIRRHILKVAHLTSNALALIN 584
            N++++ ++  C+ T YR+ C  +L +   K  ++P  L  TA N+T+K     ++    +  +       T  A+  C E++  ++DEL +S +ELG          + +++ W+SAA+++E+TC++G QG    G     +++ +     LT N LA+I+
Sbjct:   52 NASVKAVKDVCAPTDYRKTCEDTL-IKNGKNTTDPMELVKTAFNVTMKQITDAAKKSQTIMELQK--DSRTRMALDQCKELMDYALDELSNSFEELGKFEFHLLDEALINLRIWLSAAISHEETCLEGFQG--TQGNAGETMKKALKTAIELTHNGLAIIS 207          
BLAST of FC929347 vs. ExPASy Swiss-Prot
Match: PME45_ARATH (Putative pectinesterase/pectinesterase inhibitor 45 OS=Arabidopsis thaliana GN=PME45 PE=2 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 8.616e-12
Identity = 45/156 (28.85%), Postives = 77/156 (49.36%), Query Frame = 3
Query:  120 IRTSCSGTIYRRLCYRSLSVYAAKIKSNPKTLANTALNITLKATKSTSRMMVKMSRIPGMIPRETAGAVADCIEVIGDSIDELQDSMDELGHIRNSNFWLTMGDVQTWVSAALTYEDTCVDGLQGRPLNGYTKTMIRRHILKVAHLTSNALALINS 587
            I+T C+ T+Y+  C  +L     K    P+T   + L   + A       + K         ++   A+A C  ++ ++ +EL  SM  +     +NF   + D+ +W+SA ++Y++TCVDG +     G  KT IR++      LTSN+LA+I S
Sbjct:   95 IQTLCNSTLYKPTCQNTLKNETKK--DTPQTDPRSLLKSAIVAVNDDLDQVFKRVLSLKTENKDDKDAIAQCKLLVDEAKEELGTSMKRINDSEVNNFAKIVPDLDSWLSAVMSYQETCVDGFE----EGKLKTEIRKNFNSSQVLTSNSLAMIKS 244          
The following BLAST results are available for this feature:
BLAST of FC929347 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 9
Match NameE-valueIdentityDescription
21KD_DAUCA3.043e-3341.2421 kDa protein OS=Daucus carota PE=2 SV=1[more]
PME2_ARATH1.087e-1426.46Pectinesterase 2 OS=Arabidopsis thaliana GN=PME2 P... [more]
PME3_CITSI4.132e-1427.36Pectinesterase 3 OS=Citrus sinensis PE=1 SV=1[more]
PME1_CITSI4.132e-1427.36Pectinesterase 1 OS=Citrus sinensis GN=PECS-1.1 PE... [more]
PME3_ARATH5.397e-1429.19Pectinesterase/pectinesterase inhibitor 3 OS=Arabi... [more]
PME28_ARATH1.018e-1228.95Putative pectinesterase/pectinesterase inhibitor 2... [more]
PMEU1_SOLLC2.267e-1226.80Pectinesterase/pectinesterase inhibitor U1 OS=Sola... [more]
PME21_ARATH2.961e-1226.71Probable pectinesterase/pectinesterase inhibitor 2... [more]
PME45_ARATH8.616e-1228.85Putative pectinesterase/pectinesterase inhibitor 4... [more]
back to top
Properties
Property NameValue
Genbank descriptionKN0AAH2BA05RM1 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH2BA05, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929347 ID=FC929347|Name=FC929347|organism=Citrus clementina|type=EST|length=889bp
AGAGAAAGAGAATGGAAGGTTCATTTTTGAGGCATACACTAGTAGCCCTG
CTCATTATTCTCCTTGAATTCTCCACCAACTTAGCCTCAAACCCATCAGA
TAATTCAAACATAGAGTACATAAGAACATCATGTAGTGGCACAATCTATC
GCAGGTTGTGCTACCGCTCACTCTCAGTCTATGCAGCCAAAATCAAAAGC
AACCCCAAAACATTAGCCAACACAGCTCTCAACATAACCCTTAAAGCCAC
AAAATCAACGTCGAGAATGATGGTCAAGATGTCGAGAATCCCCGGCATGA
TCCCGAGGGAGACCGCAGGGGCAGTGGCAGATTGCATTGAGGTGATCGGT
GACTCAATAGATGAGCTCCAAGATTCTATGGACGAACTGGGTCACATCAG
GAACTCGAATTTTTGGCTCACAATGGGTGATGTCCAAACATGGGTAAGCG
CAGCGTTAACGTATGAAGATACTTGCGTGGATGGGCTTCAAGGTAGGCCC
TTGAACGGATATACGAAGACGATGATCAGGAGGCATATTCTTAAAGTTGC
ACATTTGACGAGCAACGCCTTGGCTCTCATAAATAGTTATGCCGCTGGCA
GTAACCCTCCATCTCCCTAAAGGGATCGGATCAAAGCCATTCTAAATCAC
TAATTAGAAACGCTCTTTCATGCTACTTCATATAGCGTTGTCCTGTATAT
TTTCGTATCTTTAATTTGTGTCAGACTCAAGAGTGTCGGTCGGTTTTAAT
TATCCTATTTCTTTGAGATATATTTACATGTGTATAGGACAAAATTGCCA
TANGGCTAGCGTGGATTGCAAGCTGATATGTGTGTGATAGACTGTTACTG
TAATTTTCTATGTCTATTACAGAAGCAAGATGTAAAATA
back to top