FC929360

Overview
NameFC929360
Unique NameFC929360
TypeEST
OrganismCitrus clementina (Clementine)
Sequence length812
Libraries
Library NameType
PhII-IIIV1cdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Ccv1_Contig10210 contig Ccv1_Contig10210:152..964. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of FC929360 vs. ExPASy Swiss-Prot
Match: PIP25_ARATH (Probable aquaporin PIP2-5 OS=Arabidopsis thaliana GN=PIP2-5 PE=1 SV=1)

HSP 1 Score: 437.573 bits (1124), Expect = 3.980e-122
Identity = 213/254 (83.86%), Postives = 224/254 (88.19%), Query Frame = 1
Query:   16 SYSAKDYTDPPPEPLFDAVELTKWSFYRALIAEFIAXXXXXXXXXXXXIGYKSQTDPAKNVDGCAGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAISGVGLVKAFQKSYYTRYGGGANELADGYSTGVGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNKDKAWDDQWLFWVGPFIGAAIAAFY 777
            S+S KDY DPPPEPLFDA EL KWSFYRALIAEFIA            IGYKSQTDPA N D C GVG+LGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGL LARKV+LVRAVMYMVAQCLGAI GV LVKAFQ +Y+TRYGGGAN L+DGYS G G+AAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVF+VHLATIPITGTGINPARSLGAA+IYNKDKAWD  W+FWVGPF GAAIAAFY
Sbjct:   11 SFSGKDYQDPPPEPLFDATELGKWSFYRALIAEFIATLLFLYVTIMTVIGYKSQTDPALNPDQCTGVGVLGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLARKVTLVRAVMYMVAQCLGAICGVALVKAFQSAYFTRYGGGANGLSDGYSIGTGVAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSLGAAIIYNKDKAWDHHWIFWVGPFAGAAIAAFY 264          
BLAST of FC929360 vs. ExPASy Swiss-Prot
Match: PIP23_MAIZE (Aquaporin PIP2-3 OS=Zea mays GN=PIP2-3 PE=2 SV=1)

HSP 1 Score: 429.869 bits (1104), Expect = 8.298e-120
Identity = 213/261 (81.61%), Postives = 224/261 (85.82%), Query Frame = 1
Query:    1 GTRHGSYSAKDYTDPPPEPLFDAVELTKWSFYRALIAEFIAXXXXXXXXXXXXIGYKSQTDPAKNVD--GCAGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAISGVGLVKAFQKSYYTRYGGGANELADGYSTGVGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNKDKAWDDQWLFWVGPFIGAAIAAFY 777
            G   G +SAKDYTDPPP PL DA ELTKWS YRA+IAEFIA            IGYK QTD A +     C GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRA++Y++AQCLGAI GVGLVK FQ +YY RYGGGANEL+DGYS G GLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNKDKAWDDQW+FWVGP IGAAIAA Y
Sbjct:   10 GPEAGEFSAKDYTDPPPAPLIDADELTKWSLYRAVIAEFIATLLFLYITVATVIGYKHQTDAAASGPDAACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRALLYIIAQCLGAICGVGLVKGFQSAYYVRYGGGANELSDGYSKGTGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNKDKAWDDQWIFWVGPLIGAAIAAAY 270          
BLAST of FC929360 vs. ExPASy Swiss-Prot
Match: PIP24_MAIZE (Aquaporin PIP2-4 OS=Zea mays GN=PIP2-4 PE=1 SV=1)

HSP 1 Score: 427.557 bits (1098), Expect = 4.118e-119
Identity = 211/261 (80.84%), Postives = 224/261 (85.82%), Query Frame = 1
Query:    1 GTRHGSYSAKDYTDPPPEPLFDAVELTKWSFYRALIAEFIAXXXXXXXXXXXXIGYKSQTDPAKNVD--GCAGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAISGVGLVKAFQKSYYTRYGGGANELADGYSTGVGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNKDKAWDDQWLFWVGPFIGAAIAAFY 777
            G   G +SAKDYTDPPP PL DA ELT+WS YRA+IAEFIA            IGYK QTD + +     C GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRA++Y++AQCLGAI GVGLVK FQ +YY RYGGGANEL+DGYS G GLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNKDKAWDDQW+FWVGP IGAAIAA Y
Sbjct:    9 GPEAGEFSAKDYTDPPPAPLIDAEELTQWSLYRAVIAEFIATLLFLYITVATVIGYKHQTDASASGPDAACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRALLYIIAQCLGAICGVGLVKGFQSAYYVRYGGGANELSDGYSKGTGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNKDKAWDDQWIFWVGPLIGAAIAAAY 269          
BLAST of FC929360 vs. ExPASy Swiss-Prot
Match: PIP22_ORYSJ (Probable aquaporin PIP2-2 OS=Oryza sativa subsp. japonica GN=PIP2-2 PE=2 SV=1)

HSP 1 Score: 424.861 bits (1091), Expect = 2.669e-118
Identity = 207/257 (80.54%), Postives = 220/257 (85.60%), Query Frame = 1
Query:   13 GSYSAKDYTDPPPEPLFDAVELTKWSFYRALIAEFIAXXXXXXXXXXXXIGYKSQTDPAKNVD--GCAGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAISGVGLVKAFQKSYYTRYGGGANELADGYSTGVGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNKDKAWDDQWLFWVGPFIGAAIAAFY 777
            G +SAKDYTDPPP PL D  ELTKWS YRA+IAEFIA            IGYK Q+D   N     C+GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSL+RAV+Y++AQCLGAI GVGLVK FQ SYY RYGGGANEL+DGYS G GL AEIIGTFVLVYTVFSATDPKR+ARDSH+PVLAPLPIGFAVFMVHLATIPITGTGINPARSLG AVIYNKDKAWDDQW+FWVGP IGAAIAA Y
Sbjct:   13 GEFSAKDYTDPPPAPLIDVEELTKWSLYRAVIAEFIATLLFLYITVATVIGYKHQSDATVNTTDAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYIIAQCLGAICGVGLVKGFQSSYYARYGGGANELSDGYSKGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGTAVIYNKDKAWDDQWIFWVGPLIGAAIAAAY 269          
BLAST of FC929360 vs. ExPASy Swiss-Prot
Match: PIP22_ARATH (Aquaporin PIP2-2 OS=Arabidopsis thaliana GN=PIP2-2 PE=1 SV=2)

HSP 1 Score: 420.239 bits (1079), Expect = 6.575e-117
Identity = 204/253 (80.63%), Postives = 215/253 (84.98%), Query Frame = 1
Query:   19 YSAKDYTDPPPEPLFDAVELTKWSFYRALIAEFIAXXXXXXXXXXXXIGYKSQTDPAKNVDGCAGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAISGVGLVKAFQKSYYTRYGGGANELADGYSTGVGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNKDKAWDDQWLFWVGPFIGAAIAAFY 777
            +  +DY DPPP P FDA ELTKWS YRA+IAEF+A            IGYK Q+D       C GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSL+RAV+YMVAQCLGAI GVG VKAFQ SYY RYGGGAN LADGY+TG GLAAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS GAAVIYNK K WDD W+FWVGPFIGAAIAAFY
Sbjct:   11 FQTRDYEDPPPTPFFDADELTKWSLYRAVIAEFVATLLFLYITVLTVIGYKIQSDTKAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAVLYMVAQCLGAICGVGFVKAFQSSYYDRYGGGANSLADGYNTGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNKSKPWDDHWIFWVGPFIGAAIAAFY 263          
BLAST of FC929360 vs. ExPASy Swiss-Prot
Match: PIP22_MAIZE (Aquaporin PIP2-2 OS=Zea mays GN=PIP2-2 PE=2 SV=1)

HSP 1 Score: 417.157 bits (1071), Expect = 5.566e-116
Identity = 203/263 (77.19%), Postives = 220/263 (83.65%), Query Frame = 1
Query:    1 GTRHGSYSAKDYTDPPPEPLFDAVELTKWSFYRALIAEFIAXXXXXXXXXXXXIGYKSQTDPAKNVDG----CAGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAISGVGLVKAFQKSYYTRYGGGANELADGYSTGVGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNKDKAWDDQWLFWVGPFIGAAIAAFY 777
            G   G ++AKDYTDPPP PL DA EL  WS YRA+IAEFIA            IGYK QTD + +  G    C GVG+LGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRA++YMVAQCLGA+ GVGLVKAFQ +Y+ RYGGGAN LA GYS G GL AEI+GTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSLGAAV+YNKDK WDD W+FWVGP +GAAIAAFY
Sbjct:   10 GAGGGEFAAKDYTDPPPAPLVDAAELGSWSLYRAVIAEFIATLLFLYVTVATVIGYKHQTDASASGAGADAACGGVGVLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRALLYMVAQCLGAVCGVGLVKAFQSAYFDRYGGGANSLASGYSRGAGLGAEIVGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVVYNKDKPWDDHWIFWVGPLLGAAIAAFY 272          
BLAST of FC929360 vs. ExPASy Swiss-Prot
Match: PIP21_MAIZE (Aquaporin PIP2-1 OS=Zea mays GN=PIP2-1 PE=1 SV=2)

HSP 1 Score: 417.157 bits (1071), Expect = 5.566e-116
Identity = 206/261 (78.93%), Postives = 219/261 (83.91%), Query Frame = 1
Query:    1 GTRHGSYSAKDYTDPPPEPLFDAVELTKWSFYRALIAEFIAXXXXXXXXXXXXIGYKSQTDP-AKNVDG-CAGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAISGVGLVKAFQKSYYTRYGGGANELADGYSTGVGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNKDKAWDDQWLFWVGPFIGAAIAAFY 777
            G   G ++AKDYTDPPP PL DA EL  WS YRA+IAEFIA            IGYK QTD  A   D  C GVG+LGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRA++Y+VAQCLGAI GVGLVKAFQ +Y+ RYGGGAN LA GYS G GL AEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSLGAAVIYNKDK WDD W+FWVGP +GAAIAAFY
Sbjct:   10 GAGGGEFAAKDYTDPPPAPLIDAAELGSWSLYRAVIAEFIATLLFLYITVATVIGYKHQTDASASGADAACGGVGVLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRALLYIVAQCLGAICGVGLVKAFQSAYFDRYGGGANSLASGYSRGTGLGAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYNKDKPWDDHWIFWVGPLVGAAIAAFY 270          
BLAST of FC929360 vs. ExPASy Swiss-Prot
Match: PIP21_ARATH (Aquaporin PIP2-1 OS=Arabidopsis thaliana GN=PIP2-1 PE=1 SV=1)

HSP 1 Score: 416.772 bits (1070), Expect = 7.270e-116
Identity = 202/253 (79.84%), Postives = 213/253 (84.19%), Query Frame = 1
Query:   19 YSAKDYTDPPPEPLFDAVELTKWSFYRALIAEFIAXXXXXXXXXXXXIGYKSQTDPAKNVDGCAGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAISGVGLVKAFQKSYYTRYGGGANELADGYSTGVGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNKDKAWDDQWLFWVGPFIGAAIAAFY 777
            +  +DY DPPP P  D  EL KWSFYRA+IAEF+A            IGYK Q+D       C GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSL RA++Y++AQCLGAI GVG VKAFQ SYYTRYGGGAN LADGYSTG GLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS GAAVIYNK K WDD W+FWVGPFIGAAIAAFY
Sbjct:   13 FQTRDYQDPPPAPFIDGAELKKWSFYRAVIAEFVATLLFLYITVLTVIGYKIQSDTDAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLPRALLYIIAQCLGAICGVGFVKAFQSSYYTRYGGGANSLADGYSTGTGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNKSKPWDDHWIFWVGPFIGAAIAAFY 265          
BLAST of FC929360 vs. ExPASy Swiss-Prot
Match: PIP23_ORYSJ (Probable aquaporin PIP2-3 OS=Oryza sativa subsp. japonica GN=PIP2-3 PE=2 SV=1)

HSP 1 Score: 415.616 bits (1067), Expect = 1.619e-115
Identity = 204/257 (79.38%), Postives = 219/257 (85.21%), Query Frame = 1
Query:   13 GSYSAKDYTDPPPEPLFDAVELTKWSFYRALIAEFIAXXXXXXXXXXXXIGYKSQTDPAKNVD--GCAGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAISGVGLVKAFQKSYYTRYGGGANELADGYSTGVGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNKDKAWDDQWLFWVGPFIGAAIAAFY 777
            G Y AKDY+DPPP PL DA ELTKWS YRA+IAEF+A            IGYK Q+DP  N     C+GVGILGIAWAFGGMIF+LVYCTAG+SGGHINPAVTFGLFLARKVSLVRAV+Y+VAQ LGAI GVGLVK FQ ++Y RYGGGANEL+DGYS G GLAAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYN+ KAW D W+FWVGP IGAAIAA Y
Sbjct:   14 GEYMAKDYSDPPPAPLIDAEELTKWSLYRAVIAEFVATLLFLYITVATVIGYKHQSDPGANAADAACSGVGILGIAWAFGGMIFILVYCTAGVSGGHINPAVTFGLFLARKVSLVRAVLYIVAQSLGAICGVGLVKGFQSAFYVRYGGGANELSDGYSKGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNQHKAWHDHWIFWVGPLIGAAIAAAY 270          
BLAST of FC929360 vs. ExPASy Swiss-Prot
Match: PIP25_MAIZE (Aquaporin PIP2-5 OS=Zea mays GN=PIP2-5 PE=1 SV=1)

HSP 1 Score: 413.69 bits (1062), Expect = 6.154e-115
Identity = 202/256 (78.91%), Postives = 219/256 (85.55%), Query Frame = 1
Query:   16 SYSAKDYTDPPPEPLFDAVELTKWSFYRALIAEFIAXXXXXXXXXXXXIGYKSQTDPAKNVD--GCAGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCLGAISGVGLVKAFQKSYYTRYGGGANELADGYSTGVGLAAEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNKDKAWDDQWLFWVGPFIGAAIAAFY 777
            ++  KDY+DPPP PL DA ELTKWS YRA+IAEF+A            IGYK QTD A +     C GVG+LGIAWAFGGMIF+LVYCTAG+SGGHINPAVTFGLFLARKVSLVRA++Y+VAQCLGAI GVGLVK FQ ++Y RYGGGANEL+ GYS G GLAAEIIGTFVLVYTVFSATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYN DKAWDD W+FWVGPFIGAAIAA Y
Sbjct:   10 AHEGKDYSDPPPAPLVDAEELTKWSLYRAVIAEFVATLLFLYITVATVIGYKHQTDAAASGPDAACGGVGVLGIAWAFGGMIFILVYCTAGVSGGHINPAVTFGLFLARKVSLVRALLYIVAQCLGAICGVGLVKGFQSAFYVRYGGGANELSAGYSKGTGLAAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNNDKAWDDHWIFWVGPFIGAAIAAAY 265          
The following BLAST results are available for this feature:
BLAST of FC929360 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 194
Match NameE-valueIdentityDescription
PIP25_ARATH3.980e-12283.86Probable aquaporin PIP2-5 OS=Arabidopsis thaliana ... [more]
PIP23_MAIZE8.298e-12081.61Aquaporin PIP2-3 OS=Zea mays GN=PIP2-3 PE=2 SV=1[more]
PIP24_MAIZE4.118e-11980.84Aquaporin PIP2-4 OS=Zea mays GN=PIP2-4 PE=1 SV=1[more]
PIP22_ORYSJ2.669e-11880.54Probable aquaporin PIP2-2 OS=Oryza sativa subsp. j... [more]
PIP22_ARATH6.575e-11780.63Aquaporin PIP2-2 OS=Arabidopsis thaliana GN=PIP2-2... [more]
PIP22_MAIZE5.566e-11677.19Aquaporin PIP2-2 OS=Zea mays GN=PIP2-2 PE=2 SV=1[more]
PIP21_MAIZE5.566e-11678.93Aquaporin PIP2-1 OS=Zea mays GN=PIP2-1 PE=1 SV=2[more]
PIP21_ARATH7.270e-11679.84Aquaporin PIP2-1 OS=Arabidopsis thaliana GN=PIP2-1... [more]
PIP23_ORYSJ1.619e-11579.38Probable aquaporin PIP2-3 OS=Oryza sativa subsp. j... [more]
PIP25_MAIZE6.154e-11578.91Aquaporin PIP2-5 OS=Zea mays GN=PIP2-5 PE=1 SV=1[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionKN0AAH2BB07RM1 PhII-IIIV1 Citrus clementina cDNA clone KN0AAH2BB07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>FC929360 ID=FC929360|Name=FC929360|organism=Citrus clementina|type=EST|length=812bp
GGCACGAGGCACGGCTCATATTCAGCCAAGGACTACACGGACCCACCGCC
GGAGCCGCTATTCGACGCCGTGGAGCTGACCAAATGGTCATTCTACAGAG
CCTTGATAGCTGAGTTCATAGCAACCCTGCTCTTTCTTTACGTCACTGTC
TTGACTGTCATTGGCTACAAAAGCCAGACCGATCCCGCCAAGAACGTCGA
CGGCTGTGCCGGCGTCGGCATCCTCGGCATCGCCTGGGCCTTCGGTGGCA
TGATCTTTGTCCTCGTTTACTGCACCGCCGGTATCTCAGGTGGTCACATT
AACCCGGCAGTGACGTTCGGACTATTCTTGGCCCGCAAGGTGTCGTTGGT
CCGTGCTGTGATGTACATGGTGGCGCAGTGCCTTGGTGCTATCTCCGGTG
TTGGGTTGGTCAAGGCTTTCCAAAAATCTTACTACACAAGGTACGGAGGT
GGGGCCAACGAGCTGGCCGATGGGTACAGCACCGGCGTTGGATTGGCCGC
CGAGATCATCGGCACCTTTGTCTTGGTTTACACTGTCTTCTCGGCCACTG
ATCCCAAGAGAAGCGCCAGAGACTCCCACGTTCCCGTTTTGGCACCGCTC
CCCATTGGATTTGCTGTGTTCATGGTACACTTGGCCACAATCCCAATCAC
TGGCACTGGCATTAACCCAGCAAGGAGTCTCGGGGCCGCTGTTATTTACA
ACAAGGACAAGGCTTGGGATGATCAATGGCTCTTCTGGGTTGGACCCTTC
ATTGGTGCAGCAATTGCAGCTTTCTACCCCAATTCATCTTGAGAGCTGGA
GCTGTCAAGGCT
back to top